SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P22880_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P22880_001
Domain Number 1 Region: 77-155
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000007
Family Ankyrin repeat 0.0029
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr1P22880_001
Domain Number - Region: 253-283
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00314
Family CCCH zinc finger 0.0042
Further Details:      
 
Domain Number - Region: 453-514
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 0.1
Family gamma-adaptin C-terminal appendage domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P22880_001
Sequence length 619
Comment pep:novel chromosome:MA1:1:17211335:17214032:-1 gene:GSMUA_Achr1G22880_001 transcript:GSMUA_Achr1T22880_001 description:"Zinc finger CCCH domain-containing protein 24"
Sequence
MCGGPERVGPSSPSPASREDNGVMDYITDDSFSSLLELAANNDAGGFRRSLDRDPSAVDE
VCLWYGREKGSNRMVLERHTPLMVAATYGSLDVLGLLLSSPSVLVNRASGRDRATALHCA
ASGGSPDAADAVRLLLSAGADPDLVDANGRRPADVVIVPPKLPDPLSSSLDSDGSPSITT
KASELQPPAVPEKKEYPVDPSLPDIKNSIYATDEFRMYSFKVRPCSRAYSHDWTECPFVH
PGENARRRDPRKYHYSCVPCPDYRKGACRRGDMCEYAHGVFECWLHPAQYRTRPCKDGTS
CSRRVCFFAHTNEELRPLHTATDSALPSPLSSASAAMEMAAALSLMPGSSSSVSSVMSPF
TPPMSPSANGIGHSSFSWAHSNMPAVHLPGSNLQSSRLRASLSARDMPVDDPIARAKAFT
LDDIFSAEPTSSPKYNSDQGAIFSPSHITAALNQFQRQQQSLLSPINTSISPVSSHLSLL
AQREKQKLMLRSLSSRDAGSGTSPVVGSPVNHSWLKWASPTSSLDWEVNGEELGCLRQPS
SFELQATGEEPDLSWVHSLVRDSPTENVVAASGAPAGLSSSPHANGIEGLNRDGQSDDLD
QAALLGSWLDQLQLDQMVI
Download sequence
Identical sequences M0S296
GSMUA_Achr1P22880_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]