SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P23920_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P23920_001
Domain Number 1 Region: 351-380,568-738
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-23
Family G proteins 0.00054
Further Details:      
 
Domain Number 2 Region: 380-533
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 4.84e-21
Family Transducin (alpha subunit), insertion domain 0.0016
Further Details:      
 
Domain Number 3 Region: 107-181
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000144
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P23920_001
Sequence length 766
Comment pep:novel chromosome:MA1:1:18323340:18333792:-1 gene:GSMUA_Achr1G23920_001 transcript:GSMUA_Achr1T23920_001 description:"Putative Guanine nucleotide-binding protein alpha-2 subunit"
Sequence
MSENMDENSWQEMLRRILPPGTPIPEAPANLDYSIAIEYDGPPVSYELPRVDPVDLIPTA
EPVLGSHRLVNDDLPPVVDPITLPVSRIARCADPPQRSPQVSGSSESEKSESKEIYEDVK
GSPQYVAVTWNDKKKRVCYRCGKRKWESKEACLVCDARYCSYCVLRAMGSMPEGRKCVSC
IGQPIDESKRSKLGKSSRTLSRLLNPLEVRQILKAEKECPANQLRPEQLIEGEKPDRIIS
SNLNFTGKLHAEASNGNTEVYINGREITRVERRVLKFANVQCPRDTHFWVYDDGRYEEEG
QNNIRGNIWESTLTRLACSLFSLPVPHSVPTGSRNEAPYVARPVPDYLEQRVQKLLLLGP
QGSGTSTIFKQVKFLYGNEFSQEELENIKLMIQSNMYKYLSILLEERERFEEEALARLER
TGSHDQSSTEGQVESETSRPNQCIYSINGKLKQFSDWLLDIVAMGDLDAFFPAATREYAP
LVDEMWKDPAIQETYKRRNELHYLPDIAEYFLSKAIEVSSNEYEPSEKDILYAEGVTQGN
GLAFIEFSLDDHSPMSELYNDNPDVHSQPLTKYQLIRVSAEGMNESCKWVEMFEDVRLVI
FCVALSDYDQLAAAANDSSKPLQNKMIQSKELFEATVRQPCFQDTPFVLVLNKYDLFEEK
INRAPLSSCEWLKEFRPVRTHQSNQSLAHQAYYYIAMKFKDLYVSLTNRKLFVWQARARD
RPTVDEAFKYMREVLKWMDENEENYFMEDSFYSTTELSSSPFIRQA
Download sequence
Identical sequences M0S2J9
GSMUA_Achr1P23920_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]