SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P27590_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P27590_001
Domain Number 1 Region: 45-125
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P27590_001
Sequence length 155
Comment pep:novel chromosome:MA1:1:24808277:24810937:-1 gene:GSMUA_Achr1G27590_001 transcript:GSMUA_Achr1T27590_001 description:"zinc finger family protein, putative, expressed"
Sequence
MGGNGSQTRGEEAADASKVSDQSAERKKSLVDWMNLIKPANEEKDHWVPDEVVSKCTSCG
SDFGAFNHRHHCRNCGDIFCDKCTKGRIALTAEENAQQVRVCDRCMAEVSQRLSNAKEAV
SKPTGLQSHEDLARRLQELNKNHKSVQILMSLGSQ
Download sequence
Identical sequences M0S3L6
GSMUA_Achr1P27590_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]