SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P27690_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P27690_001
Domain Number 1 Region: 49-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.35e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P27690_001
Sequence length 201
Comment pep:novel chromosome:MA1:1:25244037:25252193:-1 gene:GSMUA_Achr1G27690_001 transcript:GSMUA_Achr1T27690_001 description:"zinc finger family protein, putative, expressed"
Sequence
MSSSRRNSRKISSSWQTINPYFVSDQSAERKKSLVDWMNLIKPANGEKDHWVPDEAVSKC
TSCGSDFGAFNRRHHCRNCGDIFCDKCTKGRIALTAKENAQQVRVCDRCMAEVSQRLSNA
KEAVSKPAGLQSHEDLARRLQEELNKNRKSGSNSDESWKPTREVACPICTVHLQFLVQVP
ASSSQTIKCGVCQHPFLVSAD
Download sequence
Identical sequences M0S3M6
GSMUA_Achr1P27690_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]