SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr2P06290_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr2P06290_001
Domain Number 1 Region: 797-949
Classification Level Classification E-value
Superfamily SET domain 2.62e-45
Family Histone lysine methyltransferases 0.005
Further Details:      
 
Domain Number 2 Region: 188-297
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.47e-19
Family PWWP domain 0.0029
Further Details:      
 
Domain Number 3 Region: 519-583
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000151
Family PHD domain 0.012
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr2P06290_001
Domain Number - Region: 626-658
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00842
Family PHD domain 0.019
Further Details:      
 
Domain Number - Region: 353-387
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0354
Family PHD domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr2P06290_001
Sequence length 949
Comment pep:novel chromosome:MA1:2:11125252:11135806:1 gene:GSMUA_Achr2G06290_001 transcript:GSMUA_Achr2T06290_001 description:"Histone-lysine N-methyltransferase ATX4"
Sequence
MIIKRSQRVLMPTLKRCNAEVAAGDGDGEGGGRRRKRRRESFPLEVLGDVAAAGFPYVAL
GLGRWLGGEDVAGGAAREQPREAPPPSESRPPVVRTSRGRAQVLPARFNDSVLIDPWKKE
KPKPKALDSVIPNPVALFDEEERYRACRNISSKKYSLSRSTLTSLHEIKEKLHKKTSEQR
KDYCHLGGFAFGDIVWAKPGKNYPVWPAMVIDPMQQAPEHVVDSCISGAVCVMFFGYFGS
GNDTEYAWVNQGRVYPFIDHIDRFQGQTELYRCKPSDLRTAIEEAFLADHGFLGVQVDGM
SSSGEPAYLSKIKEATGSNHDQECQSEIKASKILSVENSTIILIFVPFRSKQYCQICKKI
WHHKDEKRWSSDYFCPKCKSKLNFELSDTEKNHSQVRRDHNSGKDTKLVFDNVTVWCFGM
EGIYLPEQHVVSCRCSSCKGKKFMLTEWERHTGSKTKNWRSSVKVRSTNMALGKWLDHYN
SNMVSMNHAKRPSAKVRKQKLLAFLQEAYDPVYAKWTTERCAICRWVEDWDYNKIIICNR
CQIAVHQECYGVRAKQDFTSWICRACETPQQKRECCLCPVKGGALKPTDVETLWVHVTCA
WFHPQVSFANDETMEPAVGILDIPSESFVKVCVICRQMHGSCTQCYKCSTYYHAMCASRG
GYRMELHCLEKNGKQITKKVSYCAHHRAPNPDTVLIIHTPEGVFSSKKLLQNNEKQTGSR
LIRKGILHDSDFSIQNSETPSAARCRIYRRMATKRKQEEAIAHRLMGPSHHSLDVVQSLN
APREEKDPELFSTFRERLYHLQSTEKSRVCFGRSGIHGWGLFALRNIQEGEMVIEYRGEQ
VRRSVADLREARYRLEGKGCYLFKISEEVVVDATDKGNIARLINHSCMPNCYARIMSVGN
DESRIVLIAKTNVSAGEELTYDYLFDPDEGDECKVPCLCKAPNCRKFMN
Download sequence
Identical sequences M0S5M0
GSMUA_Achr2P06290_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]