SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr2P07620_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_Achr2P07620_001
Domain Number - Region: 10-62
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000312
Family PHD domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr2P07620_001
Sequence length 160
Comment pep:novel chromosome:MA1:2:11969927:11971154:1 gene:GSMUA_Achr2G07620_001 transcript:GSMUA_Achr2T07620_001 description:"zinc finger protein, putative, expressed"
Sequence
MGSKGGVAPPPSVVCCMCGDHGLAQELFRCKVCLVRCQHKYCSDLYPKAQSYGACNWCLR
EEGAKSLAKEAVKDPNTSVSSSTNIDVGNGSSGSGGVELHHRVFSSQLHKPIKRPKLLNR
SASDVTDRSRSGELSPGSRRARQAFRGKVRRYKLLEEFSS
Download sequence
Identical sequences M0S603
GSMUA_Achr2P07620_001 XP_009389557.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]