SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr2P09830_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr2P09830_001
Domain Number 1 Region: 230-284
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000012
Family PHD domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr2P09830_001
Sequence length 1138
Comment pep:novel chromosome:MA1:2:13220441:13226923:-1 gene:GSMUA_Achr2G09830_001 transcript:GSMUA_Achr2T09830_001 description:"Hypothetical protein"
Sequence
MASVFQSSSRGQGSLDESDSERQVMVLGKFTDQNKIIFVGDMNVKSGTCNVCSATCSSCM
HRIAAAMESDGDCGSSDNIFERKEADSRSFVGAKCGSCNDLQIAASETSNLLSGSSSHDS
YSENADSKTVRKSTAYDTYEDIDIPLKVSTRLIVDDESSYQGLTAAGSDHAPKTIMLPNN
EASKAIRIRRDISSGKFMNEDGCFESASGFGSSECNLHESGKPQQSLLHGQVKVCDICGD
TGREELLATCSRCIDGAEHTYCMRIMLDKIPEGDWLCEECWMKEELEMKRLDKTETFSGK
LNVQCLNKKGENIGKSMNPENLANLNTKPTDPEACGSSKEMQNPMGTRKRHTYQMDLASP
MVKKVSETADEALKAASPKICSAFAHENSSKNFHTAEVKRTNMASSLGSQYAKSSWTSSH
SPSLGYSSSIVKEKLFPSKGGSASKQVSFKKNVEPKVEHLAEGVHQNLAKESTPRNTQYQ
SLVETINKSASFNNNSSGHHNFQSSENYQSIKSPQDEDPGSLKPKKERNVTERKSSFVLD
HPFASPHVGRKSLPDLGMKVALLNRNSSKNLEPSILGTSKGLNRENDAEYKEVKQRQPSL
KCKSYGIFDSENRKRGKFVNEEPVHANSGANNRSYNDAGGVTSSVSSFAESWHQAHSKDK
TKSIPNTSRLTISGGKSALCSGKLTKASYATQCHQIDKLTLYSAKPSADVSLIDGTSKRN
RWKDVAKAAMSRNNKSRIVDQSECRLLSNHVNSEGSSRSSLTSSICQKNFPLEGAPDGKV
ILRSSDTDYSKTDSAANMGQTEHSTKSLCNSGVGDLNVNPTNFDELNEKPSTQSLPHHPS
LLATISRSVIIPEQECIWQGAFEILKIGTITEIVDGIQAHLSMFASPKVHEVVCQFPCKI
QLEEVPRVSLWPLQFQEINPKEFNIALYFFAKDSESYERSYRKVLEAAIENDLALKGNIS
EVELLIFPSSMLPESSQRWNMLFFLWGIFRGRKSDSLKPHTDLQELCESTIITDPTVQEL
SPSHTGELSTFQKHDSQKYPPKEFSRGNESSGPSTSGPDDICKTQNFLYKAAGEKESGEL
SNHNSDLCPRIYSFDLNEICPAVKSNETNLVLFSFTRIRSMAILHIIFSLRFMGHIYI
Download sequence
Identical sequences M0S6M4
GSMUA_Achr2P09830_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]