SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr2P13300_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr2P13300_001
Domain Number 1 Region: 19-419
Classification Level Classification E-value
Superfamily Cytochrome P450 6.78e-39
Family Cytochrome P450 0.0024
Further Details:      
 
Domain Number 2 Region: 854-882,1055-1241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-17
Family G proteins 0.0012
Further Details:      
 
Domain Number 3 Region: 883-1032
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.53e-17
Family Transducin (alpha subunit), insertion domain 0.0014
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr2P13300_001
Domain Number - Region: 594-642
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00176
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr2P13300_001
Sequence length 1264
Comment pep:novel chromosome:MA1:2:15491928:15504511:1 gene:GSMUA_Achr2G13300_001 transcript:GSMUA_Achr2T13300_001 description:"Allene oxide synthase, chloroplastic"
Sequence
MASVSEKPVMAMPSSSELPVRKIPGDYGLPFVGPIQDRLAYFYFEGRDAFFKSRMRRYNS
TVFRANMPPGPFLASDPRVIVLLDAASFPLLFDTSLVEKRDLFTGTFMPSTQLTGGFRVL
SYLDPSEPNHAPLKRLLFFLLSNRRQAGKADFGAANDRAAFDFLARSFFGRNPKDSELGL
DGPGLITKWMLFQVGPLLTLGLPTYLEDLLLHSFRLPPALAERLGISREEALHNILFATC
FNSFGGMKILFPNLIKWIGRAGAPLHGRLAEEVRTAVQEIGGGEVTMRAIEAMPLTASAA
YEALRIEPPVPLQYGRAKRDMVVASHDAAFQVRAGEMLFGYQPFATRDPRVFERAEEFVA
DRFVGEGGAPLLRHVVWSNGPETEAPTAENKQCAGKDFVVMVARLLLVELFLRYDSFEIE
VGTSALGSSADPPAEADGYSFATEYDGPPLTYDIPRACPIDVDRIPLAALAPPSAARPSP
PLVLPFPSPKRPPQPSEVADGSGALWFSGDLKGVAASSSEIIPNRPSLESALSSGFSYRS
PASWNEDGEDAIAMQAEEESLGTFQESGLSSYSMSPAIGVTPQTRSEELETKIKKGACYM
CLKGSRFAVKETCLVCDARYCSSCVLTAMGSMPEGRKCVSCIGSPILESNRKRLGKSSWM
LKRLLSSLEVEQVVKAEKNSETNQLRPEHICVNGKKLSLEEMVLLQSCPCPPALKPGLYW
YDKVSGYWGKEGHRPDRIITPNLNIGGTLMQNASNGNTGILINGREITKVELQMLKWVGV
NCAGNPHFWLNADGTYLEEGQKNIKGKIWGKPVMKLLCPVLSLPFPDKVANPSGEEVNDL
VRRSVSEYLDKKTLRKLLLVGNHGSGTSTIFKQAKFLYRSVPFPEVERQDTKLMIQTSIY
NYIGILLEGRELFEEESLAERKGNQQLRFSGDAELDKEKIVTEYSISPRLKAFSDWLLKL
MASGKLEDIFPAATREYAPLVEELWNDSAIQATYKRSSELQPIPSIASYFLERVVDISRV
EYEPSDMDILYADGITSSNGLACVDFHFPELPCAGMSINDHDHQETLSRYQLIRVHNKGL
GENCKWLHLFEDVRIVIFCVSLTDYDEYYEDLNGVVMNKMMENKRLFEIIARAFKQINFL
LILSKFDLLEQKIATAPLTLCKWFDDFDPVASHHRRNNSRNNRGTNIESTKSEQAFQYVA
VKFKRLFLSITGRKLFVTWANGLDSDSVDTAIRYASEIIKWDEEWSMCDSIESMYNTEPS
LFSH
Download sequence
Identical sequences M0S7M1
GSMUA_Achr2P13300_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]