SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr2P18660_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr2P18660_001
Domain Number 1 Region: 481-609
Classification Level Classification E-value
Superfamily Plus3-like 8.11e-35
Family Plus3 0.00074
Further Details:      
 
Domain Number 2 Region: 343-420
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.5e-19
Family SWIB/MDM2 domain 0.00091
Further Details:      
 
Domain Number 3 Region: 800-859
Classification Level Classification E-value
Superfamily GYF domain 2.88e-18
Family GYF domain 0.00054
Further Details:      
 
Domain Number 4 Region: 121-177
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000178
Family PHD domain 0.01
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr2P18660_001
Domain Number - Region: 1664-1685
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00053
Family CCCH zinc finger 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr2P18660_001
Sequence length 1686
Comment pep:novel chromosome:MA1:2:19002848:19014909:1 gene:GSMUA_Achr2G18660_001 transcript:GSMUA_Achr2T18660_001 description:"Hypothetical protein"
Sequence
MEPRDGDLQDAYFPHPFDDAVVQRTPPPPVSPDDEEADQGDAQVAGAYEMDDSQLVSSPF
ALSPAFEPSQEDAAGEEALPMSEAAAAVAAVEASGPVKRKRGRPPKAHGPGRAPVPKKKK
EEEEVCFICFDGGDLVLCDRRGCPKVYHPACINRDEAFFRSRARWNCGWHICSTCQKAAT
YMCFTCTYSLCKACIREARFFCVRGNKGFCEACYRTIMLIESNGQDNEEKVRVDFDDKSS
WEYLFKVYWLTLKGKLSVTIEDLHNAKNPWKGCDTSMYNEETSDELYNANDDQEASSDST
PGHHEGSISSRKKVRKRSKKSAEIEVPAQDVDSEKKSLSEDSKWASPVLLEFVAHMKNGD
KSVLSQFDVQALLLDYIKRNNLRDPRRKSQIICDARLQNMFGKLRVGHFEMLKLLESHFL
IKEAPQIGMDDNQGGTIDSDSGQIDAEEHSMASIGSDKRLKTRKRVGERELQANLDEYAA
IDAHNINLIYLRRNLMEDLINDDNFSKNVVGSFVRIRISGAGQKQDMYRLVQIIGTHVLA
EKYKLGKKTTDIALEILNLNKTEILSIDSISNQDFTEEECKRLRQSIKCGLINRLTVGDL
LEKAQVLQEVRVKDWLENEKLRLSHLRDRAIVLNLRLECIEKLQILNKPEEYQRRIREVP
EIHVDTHMDPNYESPEEEADNKKEDNFSRSRGSLSRRKGKELISPGRRGSISNYHLNDAT
KSLSTSWMSGTQTGGAEEKIETIVTLGDRKCEISRTESNIGWTDSSGTLMNGNKLVTGVE
HPCGVAPDTMISSPGVPLPSNVSESDKVWQYQDPSGKIQGPFSMSQLRKWSSTGYFPPDL
RVWLKSQKQEDSMLLADVLPEFLKDTQQKEPQLTNFSQPTNFVAEANTGHNWDIVSRGDT
NPTSVGIKQNNHWSANQNDITMSIAGYKMSNVDRWAPQAPNYIEPRRELMITEERRIGIS
PRAWESTKDTNAWYGQHTSHNTPSTKISVPFAGNPYDTPAYQVTGGQASNAEGRNRNQEH
GSSWSSFRSKPTRPSDQGYDERHSNWSSSGQLSHQVSAQYQQIQPVSYSKRQWVNDAHNP
PTPTPQPSGMVWTRDRDHLSASSAAAAISVQSAGCGWEATPSAEFSEFDQLAAESMEGKG
SVPEMTSAGGWAKTSCNLLNQSAAREVWGSGSTASLATSGANQNFGKVDNLDEPSWASKQ
EKPFESNATTLSGSFMKKSHFFESSCPSPTPSSERDDIPLSQISEPDPDDKWNEASGTPT
AESEAIAPDTTVLASMPLDLSVLSSQVVRSMDEVADQSTEIENLSPFSSATENNQRSLAG
TSDNLGNLPLSAIPAAKPDAVESVSVQEPDSMVGSQVVSELKEAKYDLDGLHASVSSSGS
GLDQNQAKNLECFSGSKCVLEDTKLPSPTPASEPSGRVLAIDSTSGKSQSDTLGLSDVFV
SPLSPIRSDPSTGPAAFGNPASSMAEGASDQGWTQGSANIIWGISGQRQTSTETGWMMPK
QKRTSANTSWVTPAQGNREENLGWVTQGNMNPNAGWGVPTASSPGSNLEESIKVNSEAET
GWGVPGAGNINWSPQKQQGDDDTGWGTALGSNNAGWSSSAGYHDVLISQKRHGGDRYQGG
REPGHGGGNNPRNKTYIGGDGGGGWSQPPPRGQWQGLGRGHVQRGVCKFHESGHCKKGAS
CKYLHR
Download sequence
Identical sequences M0S957
GSMUA_Achr2P18660_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]