SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr2P18960_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr2P18960_001
Domain Number 1 Region: 177-240
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.1e-19
Family PHD domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr2P18960_001
Sequence length 242
Comment pep:novel chromosome:MA1:2:19167892:19177137:-1 gene:GSMUA_Achr2G18960_001 transcript:GSMUA_Achr2T18960_001 description:"PHD finger protein At5g26210"
Sequence
MEVGSISSAPRSVEEIYKDYSGRRAGIIRALTNDVDEFYAQCDPEKENLCLYGHPNDSWE
VNLPAEEVPPELPEPALGINFARDGMERRDWLSLIAVHSDSWLLSVAFYLGARLNRNERK
RLFSMINELPSVFEVVSDRRQSREKSSMDSGSKSKTATKRTSDGQIKSNSKTADEGYGED
DDEHSETLCGACGGSYSADEFWIACDVCERWFHGKCVKITPAKAESIKQYKCPSCSSKKG
RQ
Download sequence
Identical sequences M0S987
XP_009387554.1.42102 GSMUA_Achr2P18960_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]