SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr2P20470_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr2P20470_001
Domain Number 1 Region: 254-559
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.31e-74
Family Regulator of chromosome condensation RCC1 0.001
Further Details:      
 
Domain Number 2 Region: 43-150
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-21
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 
Domain Number 3 Region: 558-629
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.03e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr2P20470_001
Sequence length 987
Comment pep:novel chromosome:MA1:2:20287028:20294071:-1 gene:GSMUA_Achr2G20470_001 transcript:GSMUA_Achr2T20470_001 description:"Putative Probable E3 ubiquitin-protein ligase HERC2"
Sequence
MQTIIVLLVLENIYIRSMNRLLDLLCIFIKSLYFSLTLHVFLKALLALKRGSHLLKYGRK
GKPKFYPFRLSDDASSLIWLSSGGEKSLKLVSVSKIIPGQRTPVFKRYPCSEKDHLSFSL
IYDNGTRSLDLICKDRFETEVWFAGLKALVSSGHVGRPKIDGWSDGGLYFDDLISKSPSE
RSSGSILDSSSPDISYSIKTSSVVSSENFVRLERSDVSNMLAKGASSDIIRVSVSSAPST
SSHGSVQDDCDALGDVYVWGEVIFLDVHHVACGVRHAVLVTKQGEVFTWGEESGGRLGHG
VGADVVQPRLLEVSGPLEGLQVAYVNCGTWHTASITSTGKLLTFGDGTFGALGHGSRESV
TQPREVESLMGLKTIAVACGVWHTAAVVEVIVAQPGANASSGKLFTWGDGDKYRLGHGDK
EPRLKPTCVASLIDYNFHKLACGHSLTVGLTTSGQVFTMGSTVCGQLGNPQSDGKLPCLV
EDKLVGESVGEVACGSYHVAVLTIRGEVFTWGKGANGRLGHGDIEDRKTPTLVEALKDRA
VKYIACGANFTAVICQHKWVSGAEQSQCSACRQAFGFTRKRHNCYHCGLVHCHSCSSRKA
LRAALSPNPSKPYRVCDSCYVKLNNVLEFGGINKRNGLPRLTGEIRDRFEKAEMKSTRLV
LPSNLDLMKDLDIKAARHGKKTDSLSFVRAAHASSLVQLKDLALAGGIDLQGAAPRPLRT
SMVQSVNPSRAVSPFSRKSSPPRSATPIPTTSGLSFSKSPTDTLKKTNELLNQEVQKLRA
QVDNLTERCELQEVELQKLGKKAQEATALAAEESAKSKAAKEVIKSLTSQLKDMAELLPQ
GVHKNGAIRSAGLSNGLDLHSDCQSLNSSEMEEDFSTGKRDSNAERSSSSSKADIDNKET
EHAEWIEQYEPGVYITLVAHRDGTRDLKRVRFSRRRFGEHQAESWWSENRENVYERYNVR
GSDRASSAVSRQSALRSEEDYMHSSRA
Download sequence
Identical sequences M0S9N8
GSMUA_Achr2P20470_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]