SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P03950_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P03950_001
Domain Number 1 Region: 175-275
Classification Level Classification E-value
Superfamily POZ domain 5.89e-19
Family BTB/POZ domain 0.006
Further Details:      
 
Domain Number 2 Region: 341-451
Classification Level Classification E-value
Superfamily POZ domain 4.32e-18
Family BTB/POZ domain 0.009
Further Details:      
 
Domain Number 3 Region: 40-113
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000326
Family Ankyrin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P03950_001
Sequence length 592
Comment pep:novel chromosome:MA1:3:2539813:2544226:-1 gene:GSMUA_Achr3G03950_001 transcript:GSMUA_Achr3T03950_001 description:"Putative Ankyrin repeat and BTB/POZ domain-containing protein 1"
Sequence
MDETSSRQRWEMEAELGEMDLDPEDLQPSVPLKRVPAGDLFEAARAGDLDRLRYLLDSGV
NVNARDPWDSVALYYACLAGHVDAARMLLDAGAICSERTFDGDRCHYAALNLRVRRLLKA
FEARPPPLAPLPAALRDTFLSCAANRRAYIEQWEAGAGSAACAAGYLPLSDGSTSSPFPP
DITFYVDGKPIEAHRVVLSARSPFFKKKFETDWKDRKEVRFSSQKLSYHALYSLIHFFYS
DRLEVAVDDMEDLARTCRACKCDELQNILQKELIHQRYAEYKSLKDVDNSQKRFILQGLS
LPEQDRLPFALHRILQVSLANSCGRNNDSVDRLEIQMSQPSNDLADICIKVGRRIYRCHQ
VILASRSEYFRARLSRMTDFLDGNNELSSFTLPFLEEHDLSTEAFEKMIEYMYTDGLKDM
EPDQAEEIFDAASRYLLFPLKRAVADVLLPHLELVSPAELCHWLILSDMYGVLKIREYCL
DVIACNFETFADTREFRAMLLTFPPPSGDSSLRTTRPSAPGSTGNSDQGNLLDDLREKWL
EAEAAELDKRDESAALFDKRLEVLMLVAEREDNKVHSDPIERKHFDQASPRV
Download sequence
Identical sequences M0SBL3
XP_009390638.1.42102 GSMUA_Achr3P03950_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]