SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P05600_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P05600_001
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000421
Family PHD domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P05600_001
Sequence length 222
Comment pep:novel chromosome:MA1:3:3714314:3720216:-1 gene:GSMUA_Achr3G05600_001 transcript:GSMUA_Achr3T05600_001 description:"PHD-finger domain containing protein, putative, expressed"
Sequence
MLICDLCEEAFHVSCCRPKIRNLPVDEWFCQSCFSKKPKSFIDEKSGKTCTLVDEFPGHR
RRVSHRVLDPIAFMLRDGQPYTTGARIGKDFQAEVPDWSGPKPDGFNPYGEPSEVDPAEY
SSLSVWNNSRPPKSTSIGNWVQCREVVYTGDDDEGTVCRKWRRAPLFVVQTDDWDCSCAV
LWDAIHADCAVPQELETEVVLKHLKFIEMLKPRLASRKQKFG
Download sequence
Identical sequences M0SC28
GSMUA_Achr3P05600_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]