SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P05780_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P05780_001
Domain Number 1 Region: 1313-1593
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.44e-79
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00038
Further Details:      
 
Domain Number 2 Region: 419-591
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.88e-43
Family Group II chaperonin (CCT, TRIC), apical domain 0.00034
Further Details:      
 
Domain Number 3 Region: 31-105
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.13e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr3P05780_001
Domain Number - Region: 374-425,584-611
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000702
Family GroEL-like chaperone, intermediate domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P05780_001
Sequence length 1626
Comment pep:novel chromosome:MA1:3:3869384:3881872:1 gene:GSMUA_Achr3G05780_001 transcript:GSMUA_Achr3T05780_001 description:"chaperonin Cpn60/TCP-1, putative, expressed"
Sequence
METTDKRFPDLVTILKSWIPWRAEPTSVSRDFWMPDDSCMVCYECDSQFTIFNRRHHCRK
CGRVFCAKCTSNFVPVNSYVTENFREEELIRVCTFCFKQWEDVTASRDEGQPSGPKLSPS
LSTTSLASTKSSVTGNSITSTAVSCTCSSGAYQQASYGPAHSPSQSVHLETCHDKEDMLI
AETNMDSLADKGDRSPTHFRFCLNRCNSFSYGYRSDDDDDDDYGACHWDSEEQRLRNSDE
FYDPVDFDESEQKQGIVNNVECNASSAIYGVDSTDAETMDFENNQQLWLPPEPEDEEDEK
EAVIFEDDEEDATGEWHYLRSSNSFGSREHRSRDRSSEEHKKAMKSVVDGHFRALVAQLL
QVENISICEEDGKENWLDIITSLSWEAATLLKPDTSSGGGMDPGLYVKVKCLACGRRSDS
MVVKGVVCKKNVAHRRMLSKIEKPRFLLLGGALEYQRVTNLLSSFDTLLQQEMDHLKMAV
AKIDAHHPNVLLVEKSVSRFAQDYLLAKNISLVLNIKRPLLERIARCTGAQIVPSIDHLS
SPKLGHCDSFHVDKFLEEHGSAGQGGKKLLKTLMFFQGCPKPLGCTILLKGSNGDELKKV
KHVVQYGVFAAYHLALETCFLADEGASLPELLLKSPITVALPEKPSTVNRSISMIPGYTS
SSAEKSQSNKSDPNLGFDNSRESGLVELSFSSENHTCHSFRSASTSQSLDPFISFSHSGT
VPSSFFGDSSCYTREEIKSRFLKEDETKFTKNGNETILHCPVPTSSCHGDLETLESGRRV
GCDVQTDETKMIKMQHGFSHLGTSNQDNPRNEHMFSKEEFSPSPSDHQSILVSLSSRCVW
KGTVCERAHLFRIKYYGSFDKPLGRYLRDHLFDQSYRCRSCEMPSEAHIYCYTHLQGSLT
ISVRKLQEFHLTGERDGKIWMWHRCLRCPRVNGLPPPTRRIVMSDAAWGLSFGKFLELSF
SNHAAASRVASCGHSLHRDCLRFYGSGEMVACFKYASINVHNVYLPPSKLDFNCQHQEWV
QEEATKVFTNYFSSCYCWIILYNSLRQVEEKISKTVSHDGNTEVLESRRNIIELEAILQK
EQAEFEESKQKVTRKDSRKGQPFIDILDVNKLQKQLLAQRSFISFDASVSTAAESLNGTR
TKDGYDQYKQPASDQQNVDQQHVKKTELLSTSTNASDQSDSLESDLGENGPTLNSEESII
TDPNNLCAPMMPPRSNCDSALIEYHPEYISLFKEFMQQGWARLLPTGVDDTVIPIYDDEP
TSAISYALVCPEYHFQISDEPENFRSFGSFDDSNSSIYGSKSSLILDPLASSKSVHVRVS
FAVNGPHGKVRYTVTCYYAKCFDSLRRTCCPSELDFIRSLSRCKKWGAQGGKSNVFFAKS
LDDRFIIKQVTKTELESFIKFAPEYFKYLSDSISTGSPTCLAKILGIYQVAVKNLKGGKE
SRMDVLVMENLLFGRNVKWLYDLKGSSRSRYNADLSGNNKVLLDQNLIEAMPTSPIFVGN
KAKRLLERAVWNDTAFLASIDVMDYSLLVGVDENKNELVVGIIDFMRQYTWDKHLETWVK
ASGILGGPKDASPTVISPKQYKKRFRKAMSAYFLVVPDQWSPPMIIPSQSQSDLFQDNLL
GASQNS
Download sequence
Identical sequences M0SC46
GSMUA_Achr3P05780_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]