SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P05790_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P05790_001
Domain Number 1 Region: 584-700
Classification Level Classification E-value
Superfamily ARID-like 0.00000000000000113
Family ARID domain 0.0016
Further Details:      
 
Domain Number 2 Region: 687-752
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000942
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P05790_001
Sequence length 771
Comment pep:novel chromosome:MA1:3:3884420:3893198:1 gene:GSMUA_Achr3G05790_001 transcript:GSMUA_Achr3T05790_001 description:"AT-rich interaction region, putative, expressed"
Sequence
MSQPQGYGRENCILLAVLCGQFADRRRGDAKNRPQYPFPELVSSGRLEVQTLINPTVDRF
SEAQKLVQPNILYFQGEQLENEEQIGSLVWGGVDVSDSEMLTSFISPPLPTIVYLEIPSG
EKIAQAFHSKGVRYVIYWKSAFSSYAASYFRHALLSVVQSSCSHTWDAFQLAHASFRLYC
LRNNQVLSDSSNQKLRSKIEPHLLGDSPKINIPLPEKDLAEDGEEETDEGNGSLASVTIF
DEDMDLRFLVCGLPCTLDACLLSSLEDGLNALLNIEIRGSKLQNRVSAAPPPLQAGNFSR
GVVTMRCDITTCSSAHISLLVSGSAQTCFDDQLLECHIKSALIEKTQLVHAVPNSDDKKS
SWLNPLNSVSIACGAPVFEVCMRMPTWAAQVLKHLAPEVTYRSLVTLGIASIRGTTVASF
EKEDADRLLFFCRRQVKDFVSEETVVSCLPTWSSSLIKGRSMSGLESRPIASDYVFVEHG
MACKSAELSVKKRQRSNIAAMRPIPHPRKHKLLPFYGVPPADVNDGSQVQNNVSQTPHVK
HNSLPRAPAIQRKSTSGSLRAQQIIPLNPLPLKKHECNRPSIQVCSEEEFLKDVMQFLIL
RGHSRLVPQGGIQEFPDAILNAKRLDLYNLYREVVSRGGFYVGNGINWKGQVFSKMRNHT
ATNRMTGVGNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAPGDWVNCGLCGEWAHFGC
DRRPGLGTFKDYAKTDGLEYICPHCSLTSYKKKSQKMANGFSNTSNVSRHL
Download sequence
Identical sequences M0SC47
XP_009391205.1.42102 GSMUA_Achr3P05790_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]