SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P06790_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P06790_001
Domain Number 1 Region: 63-139
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000249
Family Chaperone J-domain 0.0032
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr3P06790_001
Domain Number - Region: 154-207
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0137
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P06790_001
Sequence length 325
Comment pep:novel chromosome:MA1:3:4576023:4577000:-1 gene:GSMUA_Achr3G06790_001 transcript:GSMUA_Achr3T06790_001 description:"heat shock protein DnaJ, putative, expressed"
Sequence
MDIDGGGRGREAAAWWMDIAHRRLRERDLVGSKRFAERAVEVDPLIGGADQIIAVADVLL
ASQRRVNNHVDWYAVLQLDPSSPAGRHPSAVRSQYRRLALLLSLVRHHLDIALSAAKLVD
DAWAVLSDPSKKALFDAELDMATAALPRQRPVPTFWTACPSCCYLHKYSCDYEGKNLRCP
SCRRAFHAAPLQAEPPVVPDTDMYYCSWGFFPLGFPDGAAAGAPGLDAQSKPFYPMSPCH
QPHPSKQTAAVVDAITPPVGGTTALKVTPLRSMKRAVAKKKVGGGLRKRVLVSESQTRTS
EGTKVSSVMDMNAEAGSSISLGSSF
Download sequence
Identical sequences M0SCE6
XP_009391343.1.42102 GSMUA_Achr3P06790_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]