SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P08160_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P08160_001
Domain Number 1 Region: 374-540,658-780
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.39e-16
Family Asparaginyl hydroxylase-like 0.079
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr3P08160_001
Domain Number - Region: 167-260
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0316
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P08160_001
Sequence length 840
Comment pep:novel chromosome:MA1:3:5773888:5781701:-1 gene:GSMUA_Achr3G08160_001 transcript:GSMUA_Achr3T08160_001 description:"Putative jmjC domain containing protein, expressed"
Sequence
MPDKTVCEKHYIQAKRRAANSAQRASERKARRKSLDDADIYLESRSKEPETSRSMSPMNV
GGAELPSESSGKSSGSSGEADGQICHHCRKNDRASVVWCISCERRGYCSGCISRWYADIP
VEDIRQVCPACRGICTCKACLQGDNLVKAKIQEMAAIDKLRYLHSLLKFILPVLKQIYAE
QCFEIGVETRIYGPKADIPRVKIDADEQLCCDFCKVPILDYHRHCTNCSYDLCLTCCRDL
RRSSSVAVRGECNQGCDDCTINFVHQFPRWKANSDGTINCGPMEAGGCGSSKLVLRRIFK
INWVAKLVKSAEEMVNGCTICDVDGLMRCPCTGNNTSESNWVSKFTRRQCSMRDGSDDNF
LYFPLSEDIKHEGISHFHEHWVKGEPVIVRHTFECPLASSWDPSIIWKGIQETIDERMDE
NMKVKAFNCYDLSEVEIELVQFIKGYSEGCMHEDGQPEMLRIKDWPTPGAVEEFILCQRP
EFLGNFPLVEFVHYKWGILNLAAKLPHDAMQNEVGPKLVISYGTHKELDKGDPVANLQVN
MGDMVSLLMHTADAALKRSEVEKSNRTFKDFEAAKPLENVNFMDSNVSLDEHTGISDISS
RECSKEDEFSLGLKTKEDTTMDIQEFNHHELSAHERRDSESTNADKHLPDPSERACAGAI
WDVFRRQDVPKLNEYLKINWTNLTSSSEFTNLVMPLYNQAVYLNNDQKKMLKEQFRIEPW
TFEQHVGEAVFIPAGCPFQVRNLQSSVQLVLDFLSPESLREAARMAEEIRCLPNNHEAKL
KMLEVGKMSMYAASSAIREIQKITLDPRLSSDVKFENRNLTALVSENIEKLTKRRQVVCS
Download sequence
Identical sequences M0SCT3
GSMUA_Achr3P08160_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]