SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P08460_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P08460_001
Domain Number 1 Region: 415-501
Classification Level Classification E-value
Superfamily E set domains 9.8e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 599-710
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000038
Family Ankyrin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 806-874
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000202
Family Motor proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P08460_001
Sequence length 979
Comment pep:novel chromosome:MA1:3:6013256:6035863:1 gene:GSMUA_Achr3G08460_001 transcript:GSMUA_Achr3T08460_001 description:"Putative Calmodulin-binding transcription activator 1"
Sequence
MAEGRRYALNPQLDIAQILQEAKSRWLRPSEICEILRNYQRFNLTPDPPYKPPGGSLFLF
DRKALRYFRKDGHNWRKKRDGKTVREAHEKLKCGSVDVLHCYYAHGEDNENFQRRSYWML
DGQLEHIVLVHYRDVNEGSRSTIPHLLNTDAMRMSHTDGSQTSSAVSPSSEFEDAESGEE
HSEASLADSLSHSGIHVASSANHTGQENVAGCSGSLAHLRSSDSIDTGILGRLFGPSSAN
QVPLQNLILGEDQQKNCSLGGASFDHHTAASKMPEFFNISRKDSGMLEENVSIEQAKWSV
NMPKIFPNTTSEGNEVKVENSENISNLDHGHLVDIPGYMFQVPNTNLSQSTLQTINNGSS
KVTVASDQPLSYEAQILYGLKKSLENEGDLKKLDSFGRWMSKEIGPSLSQEQLFTIHDFS
PDWAFSGIETKVLIAGTFLGSVEPRSIKWSCMFGEFEVSAEVLTSNVIRCKAPLHTPGRV
PFYITCSNRIACSEIREFEYRENFSSFSSVPERDLEEVILQVRFAKLLSTGLDRNWLVCS
VENCEKCFLKQKLLLMLRDQENEWNVIDKDSKAFHSDLRIPKDGLIQKLLKGKLYEWLLC
KVHEEGKGPNVLDENGQGAIHLAAALGYEWAMSPIVCAGVSPSFRDVIGRTGLHWAAYFG
REETVVELVRLGAAAGAVEHPTSKVPAGKTAADLASSRGHKGIAGYLAEADLTSHLSSLT
VKESEMGRLSATLAAEKAIENVQEQNTVSLDGGNGEQLSLRGSLAAVRNSAQAAARIQAA
FRLHSFRQRKLTDSKDKDTEISVDLMVRSYLNKFPKINHYNESLHMAAVKIQQKYRGWKG
RKEFLKIRDRIVKIQAHVRGHQVRKQYKKVVWSVSIVEKAILRWRRKGAGLRGFRAENTT
ICIEGKVGATDEYDFLRLGRRQKVASVEKALARVQSMARHPEGRDQYMRLVACSRKSKLG
DEGGGSAQLQNTEEENGGG
Download sequence
Identical sequences M0SCW3
GSMUA_Achr3P08460_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]