SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P09790_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P09790_001
Domain Number 1 Region: 1-23,119-323
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.8e-31
Family Tandem AAA-ATPase domain 0.00085
Further Details:      
 
Domain Number 2 Region: 45-107
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000576
Family PHD domain 0.0056
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr3P09790_001
Domain Number - Region: 441-497
Classification Level Classification E-value
Superfamily TPR-like 0.0524
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P09790_001
Sequence length 710
Comment pep:novel chromosome:MA1:3:7085301:7096393:1 gene:GSMUA_Achr3G09790_001 transcript:GSMUA_Achr3T09790_001 description:"Putative uncharacterized protein"
Sequence
MGLGKTLELLACIMAHRRPSLEAGFVYNNHSHDIEAEVKIKRQKWERVECICGAASESSR
YRGLWVQCDLCDAWQHAKCVGYSPKESNTSNIVKISGDYICSLCSELIEAAKIDMYTGAT
LIVCPAPILAQWQSEVMRHTRSGSLKICIYEGARSLDSLITSRTDMTELASADIVLTTYD
VLKEDLSHDSDRHDGDRHFLRYQKRYPVVPTLLTRINWWRLCLDEAQMVECNQASVTEMA
MRLHAQHRWCITGTPIQRRLDDIYGLLRFLRTNPFDVYRWWVEIIRDPYERRDRVAMQFV
YNFFRKIMWRSSKAHVAEELHLPPQEVCLSWLTFSSIEEHFYQKQHETCVSHAHEIIKNL
KDDIRKREAVFDLDASCYRFLSHSEVARLVGPLLKLRQACCHPQVGSSGLCSLQQNPLTM
EEILGVLIGKTKIEGEEALRKIVSALNGLAAIAIIEEDVKRAVLLYREALALADEHSNDF
RLDPLLNLHIHHNLAELIPLTSEFSEHCLSAGLPLENNELRKRKSSSADRFDKYYNNKTG
DVTSNVHGLAENGAKDLEHDACCFSTLDNSVNIVSEVDVPCLASPRCYAVGCLRKTCENI
KQKYLSVFTSRMSLTQEEFKSSSMQVSSILNEMENQTTIWWLHALHLISQDKESSAELTR
KIEQSLSRNAQSAGLSRVSSSNEILHFLRISKFPTNYFWWFPSHLKIFCC
Download sequence
Identical sequences M0SD96
GSMUA_Achr3P09790_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]