SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P10170_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P10170_001
Domain Number 1 Region: 107-180
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P10170_001
Sequence length 422
Comment pep:novel chromosome:MA1:3:7363397:7367371:-1 gene:GSMUA_Achr3G10170_001 transcript:GSMUA_Achr3T10170_001 description:"FYVE zinc finger domain containing protein, expressed"
Sequence
MISGLLLTRLALQHRDAQSKFHSRAQIDVNLKNVLGGIVAILTGRNKESNGIQPLQSPTS
SSLFLGSEDSGGGFLHPSVYIPSAPPFLEAEAINYNAYRAVLEADPPEWLPDSCTAACMQ
CASPFTALTRGRHHCRFCGGIFCRACSKGRCLLPVKFRERDPQRVCDACYDKLDPLQGLL
INSISNAMQSAKHDVMDWTSSRGWLNLPVGLSMEHEIYKAANTLKSYSQVARLNPERSIP
LAVLRGAKGLAILTVAKVGAFLTYKLGTGLVVAKRSDGSWSAPSSILSVGLGWGAQIGGE
LMDYIIVLHGSKAVKTFCSRMHFSLGAGLSAAAGPVGRVLEADLRAGDKGSGMCYTYSCS
KGAFVGVSLEGNLVVTRQDANTRFYGDPYLTTTDILVGTVEQPKAALPLYAALDDLCSTL
QC
Download sequence
Identical sequences M0SDD4
XP_009391713.1.42102 GSMUA_Achr3P10170_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]