SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P10630_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P10630_001
Domain Number 1 Region: 121-175
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000221
Family PHD domain 0.004
Further Details:      
 
Domain Number 2 Region: 32-87
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000243
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P10630_001
Sequence length 676
Comment pep:novel chromosome:MA1:3:7841577:7847777:1 gene:GSMUA_Achr3G10630_001 transcript:GSMUA_Achr3T10630_001 description:"Putative Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment)"
Sequence
MAPSSGSTGKGKEKMERELTAAAGEGSSAAVEEEEGETCGICFSDCKRSTRGRIDSCDHY
FCFVCIMEWAKVESRCPLCKRRFRSIRRPPVDGVFVVERVVDVPVRDQVYHPLGNESVAL
SDPYAHVSCSICHGSQNEELLLLCDLCDSGSHTYCSGLGTIVPEGDWYCPDCTISRDKHL
KSQFDDDCCPQDSVKNVDTTEVPEQSVSIYDIVADEITSNSSRRFSTIDVLDPQSTGCIS
PSRNSHHGENQDSGLQTDQSSSVSTVGKTLCGPAKCIDTGARTLRNCRNLHDRIQALREN
WNSLRAGSLHFSSNFLGAKTNEKRQSLPARTSPNISRQRTTTSHINREQTSASAYGTTQR
DSKSDNFLNSPGKRNVVQDAVNYPSKANVLKGTEKLQSGSSNCNGKSRVGKITLGTGSDD
RCFTLYQSQWSQSDFNQTPDAHKVTDLQGPRWKGDLAQQLVSSGTSTRSNFQESMVNPGS
VACSQSCVSTPPSKKLINFNTSNIEANSKEVNGNKMDGNLTMNNDRAKSNSSSKSKSLDE
INLSLPSRERHFDNRKCDLGTHVCGSLMKTNGLADNSSKSEIQSLVKLNLKLLSRDQQLG
AARFKEVARIATHTILAACGLEHSKSSARSFPSPVCQHSEQIKQHRKSKLMPSSCRECFY
TFVQNVVNSVMTEKNL
Download sequence
Identical sequences M0SDI0
GSMUA_Achr3P10630_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]