SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P12190_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P12190_001
Domain Number 1 Region: 1285-1347
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.54e-17
Family PHD domain 0.0017
Further Details:      
 
Domain Number 2 Region: 80-137
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000421
Family PHD domain 0.04
Further Details:      
 
Domain Number 3 Region: 1130-1251
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000183
Family Bromodomain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P12190_001
Sequence length 2085
Comment pep:novel chromosome:MA1:3:9023144:9042785:-1 gene:GSMUA_Achr3G12190_001 transcript:GSMUA_Achr3T12190_001 description:"PHD-finger domain containing protein, putative, expressed"
Sequence
MDPAPATASKTHEVRLAPLFIDLNEAPPPPCDTPPADPPSHGFSLDSRALACRFHASLAP
APGPAADFPGEAGVGKLPLPCGVCGRPETRGGTVVCDGCERGFHVGCVRNRLRYPAAAVD
DWLCHECSASGRPTKRWTLGAARLLDINALPPSEGDVEELQSSGNVGCRQFFLHSFSPWL
KDSSVSCLLFLFSYIIAFIFVYLRNLIIILSPVTLLIEKIKHHFKSLRRSRDQKVACVSE
AMEFYRCIVKGRKHIKNNAPNNLIIRSYKCRFALLICACDKITLIIVKNVNIFVYLSRVN
NVDVANVSGSGQPFPQHVGQIRNDCDSAKDTGSVDDFSRITEGNFCSHYKLYWKRLVLSL
SHYLFYSSIYCDSDGKRFGSGNDVAHYLGIKSSYTYVDIGEKSDVSGVVQRSLPPRRRKR
DLSRTWTATSSSENQESVRVNCSGEPSSDNEVMESQYSDFRRPSRVTNAYTEENNGHGSQ
MLNGCLPVQYEDFFVICFGRIDLRLAYHNNCQIWPVGYRSVWHDRITGSIFECEVSDGGD
AGPVFKVRRHPCSALPIPIGQTVLLYNNANKCDASERTETNCVILESDLEKDDDIIMLLS
DPSYSDLEQVSCFSSNLNQISSSLADNGRPRLVDHLGTLARFCSSAGPTNMPQVIQNHTE
FDLSCQLVAEWLNQDRFGLDMGFVKEVIETFPESHACTGYQFLANRADFSKSMTVASGVI
LAVQRNGDGSEDKVPSYGLYRRQMMLKQQDFAADHQLSDRQPPPGKPCSRRLPAELVGDV
YQIWEFLWRFYGTLGLNEPPTLEELEEELIDPWPIDSKYMEKLEKEIEDFREPDGRISLS
TCESGSTASEVSPFMFIPNETASAREAAQAKLASRTYGRCTGVTLTKIHISLLKILIGEI
LGKVTVYLDPNSDARESRSRRGRKKDVENTVAVKEAKTEILPANELTWPDLARRYILAVL
SINFVMDSPDVFTREGLKLVRCLQGDGGVLCGSLSGVAGMEADAMLLADAERQISDSRLQ
ENKVLPVDQKDSDAVSTSEPAVVNGNNLPEWALPLEPVKKLPTNVGTRIRKCIYDALDRN
PPEWAKKILEHSISKEVYKGNASGPTKKAVLSVLAEASGGKHQQKSEKRSKEKSPISLSD
AVMKRCRIVLRRAVSADEGKVFCNLLGSPIANVNDNEDEGVLGFPAMVSRPLDFRTIDLR
LAVGAYGGSHEAFLEDVREVWHNISTAYGDRPDLMQLVETLSQKFESLYEKEVLILVEKI
ADHVGNEPLDTEKRKELYNIILAANEIPKAPWEEGVCKVCGIDKDDDSVLLCDSCDSEYH
TYCLNPPLARIPEGNWYCPSCIRIQSKKQDLDQHTEVTKRHMRRHLGEEGRAFQEALYQL
ACTMDEREYWEYSVEERIFLLKFLCDEVLNTALVREHLDQCTEKSNDLQQKIRTLVMEWR
NLKFKEELLALSIAKESTSKFNEPGDVASEEGEANMYSGHGRLVEYQQNVNNSSVTDSGN
RLKGASFIIEGCPGEDGRIDFSKSVGQLFKSSVIDTHADGRKSQVQSGERDVLEERSVPG
NLNPNTTNYITMITGLVKTSGELLASKGVLQENADDVLVTSSEHESSDLGMSGLKNEISH
IEESIFSFESQLMMSSLRRDFLGRDSFGRLYWVIGRPGRHPWLVADGILMRTGPGGSDAC
STSTCDMHDRNFCSFSLYESDNEIQEITSWLSDADPKERELKECILQWQRLVHQVTNHIS
NSSQLTSKSSTSKNCTVAQSLTTKAMMILEAKYGPFLDPEVSEIPKRKGRKAKQNHERMY
RCECLEAIWPSRHHCLSCHQSFLTAVELEGHNDGRCTPNNPVSDESKENDDIIRVKGTRS
ESTRGKENPDDVDFVDTGGKGISATQDETGKGTRQANISAHNFHGNVNDEQSQRTKKSNT
GSGDGEEASSITNKIQRSGRSCTVPESSLRPLVGKISEILKCLKVNLLDMEAALPMEALR
PSRSQMPKRCAWRGFVKSSESIFEMVQATTLFEGMIKTEYLKNGWWYWSSQTAAAKTSTV
ASLALRIYTLDDSIIYVKDQVPGSDPTENLKQTTKTGKKRKDIEL
Download sequence
Identical sequences M0SDY6
GSMUA_Achr3P12190_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]