SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P16730_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P16730_001
Domain Number 1 Region: 536-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.28e-44
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 313-502
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.22e-38
Family cAMP-binding domain 0.00096
Further Details:      
 
Domain Number 3 Region: 63-310
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-30
Family Voltage-gated potassium channels 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P16730_001
Sequence length 722
Comment pep:novel chromosome:MA1:3:18017428:18023584:1 gene:GSMUA_Achr3G16730_001 transcript:GSMUA_Achr3T16730_001 description:"Potassium channel SKOR"
Sequence
MGEEVNGEFELNEVADNIEGSVGSRLSWISREYGLGNRKWSSGTKLKVSRDCYRSFVINP
NGSRSYRIWVDVVFVWSIYSAFFTPLEFGFFRGLPELLKDLDCVQVIFLADVVFQFFVAY
RDAHTYKMICDRRRIALRYLKGSFAVDLLGCVPWDSIYKMMGVEAIRFLIWVRIFRARKI
NQFFKTMEKDIKINYLFTRIVKLIMVELYCTHTAACVFYYLATTVPPAQEGYTWIGSLSM
GDYQYTNFREIDFWRRYITSLYFSIGTLATVGYGDVHAVNTREMVFSMIYISLTMILGAY
LIGNMTALIVKGSKTEQFRDKMTDLIKYMNRNKLGKDIRSQIKNHLRLQYESSYNKESVL
EDVPMALRSKISQILYLDVIQKVPLFQGCSDEFLNQIVMMLNEEFFLPGEVVIEQGSPAD
QVYIILLGYLEAVAVREDGSEESIAKLTTYDALGDAAALCNIPQRYTVRVCELCRLLRIE
KQSLANISQLYFKDGNQMLVNLLKGKGSELSIKQLEPDIKYLISKQEAELALGVNSAAYH
GDISRLQVLINAGADPNKTDYDGRTALHMAACKGHEQVVKFLIQRGSNTNCIDKFGTSPL
FETLKTGNDRIAAILVENGAILNLDDAGNYLCEVVTNGNIDLLRCLLEYGANPNSKNYDR
RTPLHVAASEGLHLMANILIEFGANVLSKDRWGNTPVDEGHRCGSKPLIKILEDAVVNHA
GK
Download sequence
Identical sequences M0SF89
GSMUA_Achr3P16730_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]