SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P20680_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P20680_001
Domain Number 1 Region: 61-305
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.9e-45
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 534-713
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.51e-42
Family Ankyrin repeat 0.00044
Further Details:      
 
Domain Number 3 Region: 309-504
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-37
Family cAMP-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P20680_001
Sequence length 803
Comment pep:novel chromosome:MA1:3:21808125:21813121:-1 gene:GSMUA_Achr3G20680_001 transcript:GSMUA_Achr3T20680_001 description:"Potassium channel AKT1"
Sequence
MAEKRKTGVFHIMPLAMMCGHEAERELSRDGSHYSLSSGILPSLGARSNRRVNLPSFIVS
PYDRRYRSWETFLVTLVVYTAWVSPFEFGFLEKSRGVLALIDNIVNVFFAIDIVLTFFVA
YLDRTTYLLIDSRKQIAWRYLSTWFILDVASTIPSEIARKILPKNLRSYGFFNMLRLWRL
RRVSSLFARLEKDRNFNYFWVRCAKLICVTLFAVHCAGCFYYFIAARYPDPSRTWIGASI
PDFHEKSLWIRYVTSMYWSITTLTTVGYGDLHAENTREMVFDIVYMLFNLGLTAYLIGNM
TNLVVHGTSRTRKYRDTIQAATGFAQRNHLPVRLQDQMISHLSLKFRTDSEGLQQQETLD
SLPKAIRSSISHYLFYSLVSNVYLFRGVNNDLLFQLVSEMKAEYFPPREDVILQNEAPTD
FYVLITGTMDLIDHSSGTEQIVQLAKSGDLVGEIGVLCYRPQLFTARTRSLCQLLRLNRT
TFLSIVQSNVGEGTKIVSNLLQYLKDQNGDPVMEGVSRDIEKMLTHGRLDLPLTLSFAVI
REDDLLLHQLLRRGLDPNESDSNGHTVLHIAASKGNEHCVCLLLEYGADPNSTDSEGSVP
LWQAMVGKHEDVVNLLIKNGAALSSGDMGSFACTAAEQNNLELLKDIIRYGGDVTLPKKD
KTTALHVAVCEGNVQLVEFLLEQGANIDTPDCNGWTPRKLADQQGHEEIKRLFEAKKDFA
TSSVPVSTPASHSIHSRLLTSKGNTTGKLVLMPDSLPELLDIGSKKFDFLPTRILTKDGA
EVDDVKLIRDGDHLVLASDAWMG
Download sequence
Identical sequences M0SGD4
GSMUA_Achr3P20680_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]