SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P21800_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P21800_001
Domain Number 1 Region: 359-480
Classification Level Classification E-value
Superfamily Plus3-like 6.41e-26
Family Plus3 0.0013
Further Details:      
 
Domain Number 2 Region: 220-309
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.4e-18
Family SWIB/MDM2 domain 0.00022
Further Details:      
 
Domain Number 3 Region: 5-63
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000345
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P21800_001
Sequence length 504
Comment pep:novel chromosome:MA1:3:22726119:22733836:1 gene:GSMUA_Achr3G21800_001 transcript:GSMUA_Achr3T21800_001 description:"Putative Zinc finger CCCH domain-containing protein 44"
Sequence
MMKKNKLNKEEIAEDYCFTCKDGGHLRVCDFKNCLKAYHPQCVGKDPSFMESDERWTCGW
HSCFICQKASALQCYCCPNSVCYSCIKEAEFVQVKKRTKGFCNNCLKLAILIEENIDVDS
DGGKVDFRDTETYEFLFKDYWEIIKDQEGLTLIDLQAANALLKRGENYKGGSDSDKLEEE
DVESEGDDLEINSDDGLSFLEDLKGRCGRMKKPIKRSRSKKKVFISWGSVELINFLISVG
RDTNEPLTLLDACEIIKDYIDRNNLHDPDNKKKKNVICDERLYALFRKRKVKFHKIESLL
ESHFATNDDSDEEISFSSEDGDTFGRRKKQNTGYDEHKLQPKEYKEDISAAPKSCYASIV
RKNINSVYLKRSLIMEFLKSPDTFEEKVTGCFVRVKVDPEDFYFVPEKRYKLGQVTGVKK
ALQTYKVGTMSTDVVLRVSNYHADVQLFFLSDDDFDEDECEDLLQLANKGLFKRPTVVSL
SFLNYFCCDRKPLSLDFSILFLSF
Download sequence
Identical sequences M0SGP6
GSMUA_Achr3P21800_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]