SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P22100_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P22100_001
Domain Number 1 Region: 290-341
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000797
Family PHD domain 0.0024
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000199
Family PHD domain 0.0068
Further Details:      
 
Domain Number 3 Region: 222-289
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000206
Family PHD domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P22100_001
Sequence length 392
Comment pep:novel chromosome:MA1:3:23018589:23020098:1 gene:GSMUA_Achr3G22100_001 transcript:GSMUA_Achr3T22100_001 description:"Putative Histone-lysine N-methyltransferase MLL2"
Sequence
MSFTFEVLPGNLMFVYLKLLHTLYVLQVWDKCQKFGEEMVLLASNLSSMSHVSCQKHVKH
CYPFLLSSELWILPVTLAGFAESNKTAMHLTFCESGQYTKLDQAKASPLYKVPTCRQCAM
EANGECSLICGGCQAMYHFSCIKPALVEIPTQSWYCVVCNAYEKESPEPFSICTRKDIMH
KNHLVYDGLKTSGTQEYCIDSDSRIVRASNSTESSVSFMETDESPELPRTAQSFLCKICG
TCEDEDKKFLICDHVHCPYKFYHIRCLKSSQIASLQQQKKSCWYCPSCLCRACFCDKDDD
RIVLCDGCDEAYHTYCMRPPCTSIPKGQWYCQSCNASMERKGTKRHKQRITQQHWKNDGT
QFNEVSRAVDLLLIAAEKLSSEEQLMAGENSR
Download sequence
Identical sequences M0SGS6
GSMUA_Achr3P22100_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]