SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P24390_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P24390_001
Domain Number 1 Region: 129-271
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000000000000023
Family Single-domain sulfurtransferase 0.031
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr3P24390_001
Domain Number - Region: 480-569
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00185
Family YdeN-like 0.094
Further Details:      
 
Domain Number - Region: 274-325
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00835
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P24390_001
Sequence length 569
Comment pep:novel chromosome:MA1:3:24923764:24929553:1 gene:GSMUA_Achr3G24390_001 transcript:GSMUA_Achr3T24390_001 description:"domain of unknown function family protein, expressed"
Sequence
MAASETPTEGGDRAGVLLYYKYAPVPDLPSLVRFYDSNCRSLALLGRVRIAPDGVNVTVG
GRMPSLEKHIAAVKSMILFEGTDFKLASCDHPSDDRIARECGFTSLSIRVVKELVTFRSD
PLLDSPKVCNAGRHLSAVEFHSVLHDAAGNNLESQAQNQFVLLDARNLYETRIGKFQATN
VETLDPKIRQYSDLPSWIDEHSEKLHGKHILMYCTGGIRCETASAYIRSKGAGFENVFQL
FGGIQRYLEQFPDGGYFKGKNFVFDHRISVGNQDDVISSCLLCGSSFDDYSSRCRCNYCR
MLVLVCYDCQAIAGRKYVCELCQRNGKGSEPMMLQENELHEELSSDSLEATEITNATFPG
VTTPTQTHKTYGKVHQLITGFWSISDQFWTVWSNNHLRKLRILCLHGFRQNASSFKGRTS
SLAKKLKDMVEFVFVDAPHQLPLIYQLRPSEPDLLSEQTTDAPSSFQHLEEQGWRMADVP
FNPLQYQQQTYGFEASYYYLKDESIRCPSLHCFGNSQGQDRQIANQASRELADMFEEECS
IVIEHDMGHIIPTRSPYLDQMKEFLRRFI
Download sequence
Identical sequences M0SHF5
GSMUA_Achr3P24390_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]