SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P24420_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P24420_001
Domain Number 1 Region: 421-497
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-19
Family Chaperone J-domain 0.00096
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr3P24420_001
Domain Number - Region: 538-572
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.046
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P24420_001
Sequence length 714
Comment pep:novel chromosome:MA1:3:24947889:24953742:-1 gene:GSMUA_Achr3G24420_001 transcript:GSMUA_Achr3T24420_001 description:"Putative uncharacterized protein"
Sequence
MARKGNHQRNGLNCHTADVQGIDSDGFKENSEMRSGKTPETEYPNNADNVCQPRSPVGKI
NKTKANGKRNRQRSGCALTREKPDDQIPSLLRSEDRSSGLRDPSKSNLSSNSFEEKRNDG
KFCHFFDGLPIGNNNGAFLAVASRNLRSLALYVLGAASEWLERQKPRLKVINSVIRKSHN
YARVKVGHAYPIILTWTLYLGKLIFLLSMVWLDCSIRGLDSLLRLGTTSFLTTIWCSILS
ITAMIGFMKILVVMVISTAMIVFIGVGLTILVVAILAMGILWFYGSFWTTGLVSLFSGVT
FMFGHERVALLISTVYSMYCARCYVGWLGLLFGLNVSFISSDILIHILKNNINDSKSNDS
SEHTRQTRSRAGHFFGESSHSSLGDDAFRSSSETPADRCPGVPSTSGTEAELSSEDEVAR
LLNCADHYSALGLTRYENVDASYLKKEYRKKAMLVHPDKNMGNEKAADAFKKLQNAYEVL
LDSLKRKTYDEELRREELLNYFRRFQNSPLKKGGQGIFRPGFSHSEAEYEGPYGEARRIA
CKKCSDFHVWICTDRSKSQARWCQDCKEFHQGKDGDGWVEQSFQPLLFGLLQKVDPPRVY
VCAKSKVYEVTEWFICQGMKCPANTHKPSFHVNTSLTKQTSSKGSGSAPRGGGATSNNEE
AITEEEFFEWLQNAMQSGMFEANNNSTTNESPSPGNGSGSKGSFKKKKKGKKQW
Download sequence
Identical sequences M0SHF8
GSMUA_Achr3P24420_001 XP_009393158.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]