SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P24520_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P24520_001
Domain Number 1 Region: 120-202
Classification Level Classification E-value
Superfamily SBT domain 3.92e-38
Family SBT domain 0.0000333
Further Details:      
 
Domain Number 2 Region: 743-845
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000014
Family Ankyrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P24520_001
Sequence length 961
Comment pep:novel chromosome:MA1:3:25028066:25036710:-1 gene:GSMUA_Achr3G24520_001 transcript:GSMUA_Achr3T24520_001 description:"Putative Squamosa promoter-binding-like protein 6"
Sequence
MEARVGSESHQFFAAGTSNLNGIGKKSFEWDLNDWRWDGELFVASQLNEIPADWFDLGIV
ENGKGEAEKRRRIIVVEEDESYGGSGSLSLKLGGHAFPVMEADLANGNKSKPQGGSSSHP
TCQVEGCGADLSDSKDYHRRHKVCEMHAKASSAVVRNAIQRFCQQCSRFHLLEEFDEGKR
SCRRRLAGHNRRRRKTHPDVIVNGNSSINEQASGYLLMSLLRVLSNLQCNLYRSIVGTVK
PSCTDILLWECTDVLPVPVPYWTGMCRLHRVVCCGTTNLADNSEPPQDQELLTHFLRNLA
SLAKSFDPSNLSQLLQASQDPQKFVTAAGTSSEAVITSVPNGVPEQVSGGPLCLTDKINC
NPGTCGRQTDHSTIDIPSNGMIVSAEPVIDGVRIKDFDLNNTYSETQDCEEGREKPATPL
CTEMSSPNCPSCLVQDSHHSSPPQSIGNSDSTSNQSQSSSHEDARCRTDRIIFKLFGKDP
TDLPLILRTQILDWLSNSPTDIESYIRPGCIILTIYLCQAESAWVQLYDDLSSNLNRLLH
NSSDDLWTTGWIFAMVQDRAAFIYDGQVVLDIPLHIKHPNHCKILSVTPIAVSHSTKVKF
TVKGFNLSQPTSRLLCSFDGKYLVQETSQSLVEAANSSGGQELSQCLSFSCLLPDVMGRG
FIEFEDCGLSNGFLPFIIAEEDVCSEIRMLENAIDVASCDDQFHERTNAEIARNQALDFI
NEFGGTVDAGRQSPMELALAENLLHSAVQMKSKALVELLLRYVPNRTSKDTDPDRFLFRP
DMLGPSGITPLHIAASTDDAENILDALTDDPGQLGIRAWKSAQDSTGFTPEGYALAQGHD
SYVRLVQNKIDKQSSPSQVVLNVSGDASDKLVDALKSSKPSVSEISRIWLSTKPQPYCNR
CSQQLVYPNSVARTMLYRPVMLSLVGIAAVCVCVGLLFKTPPQVFFVCPSFRWELLDYGF
I
Download sequence
Identical sequences M0SHG8
GSMUA_Achr3P24520_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]