SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P29760_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P29760_001
Domain Number 1 Region: 49-169
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000171
Family Ankyrin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr3P29760_001
Domain Number - Region: 266-296
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00294
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P29760_001
Sequence length 623
Comment pep:novel chromosome:MA1:3:28771977:28775319:1 gene:GSMUA_Achr3G29760_001 transcript:GSMUA_Achr3T29760_001 description:"Zinc finger CCCH domain-containing protein 24"
Sequence
MCGGPGRLKSSASSSLSPSPTSQEEHQQRSLAAGMSRLTVEIDSFSLSLLELAANNDVDA
LRLFLDRDPSAVDEVGLWYGRRKGSNRMVLEQRTPLMVAATYGSLDVLKLILSLPSVDVN
RVAGLDSTTALHCAASGGSLEAVDAVKMLLAAGADPALVDANGNRPADAIVVPPKLPDVK
TGLEQLLGRSTNASGGSDNHHHPLRKKEYPVDPSLPDIKNSIYSTDEFRMFSFKIRPCSR
AYSHDWTECPFVHPGENARRRDPRKYHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHP
AQYRTRLCKDGTGCSRRVCFFAHTNEELRPLYVSTGSAVPSPRSSSAAMEMAAAMGLMPG
SPSSVSAVMSPFTPPMSPSANGIGHSSASWPQPNVPTLTLPASNLQSSRLRSSLSARDMP
VDDLSVISETKALTPSNLDDLFSSEIASSPRYNSDQGSIFSPSHRTAVFNQFQQQQSLLS
PINTNVFPPKARERQQQSLRSLSSRDLGPISSPIVGSPVNSSWSKWASPSGVPDWGVNSE
ELGRLRRSSSFELRGNGEEPDLSWVHSLVRESPTEKVVSVATAPTGPTGGAECLNSNVEM
DGHDQAAVLGAWLEQMQLDQIVT
Download sequence
Identical sequences M0SIZ2
GSMUA_Achr3P29760_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]