SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P31620_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P31620_001
Domain Number 1 Region: 23-77
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000162
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 2 Region: 200-239
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000797
Family PHD domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P31620_001
Sequence length 1332
Comment pep:novel chromosome:MA1:3:29837607:29854190:1 gene:GSMUA_Achr3G31620_001 transcript:GSMUA_Achr3T31620_001 description:"Putative expressed protein"
Sequence
MYQQETTNGESKETTFEDEDDREDIEFENERCGICTDVIIDRGVLDCCDHWFCFACLDNW
ATITNCCPICQNEFQLITCLPVYDTTGSIRIENYSLSRSLVIIKINILKPGSCTCFLLFC
IVPSLIDCPSKPISYCFAVCLSYILPFSICREVDWSVQGKNNTLSFPSYYIDEDAVACLD
GDGCKVRSGLTTADDGLNFDTSIACDSCDIWYHAFCVGFSPEYTSVSSWLCPRCLSIEEP
QKMDDIPVQDQGWHSILKAADHGWAVDHSFLGKVSVSVADDGETALVVSMVQRDQTSKDD
TSASEDLIETNTRKETETSFSESNVDNPKLNVQVDKSGDFKLNCDDLICSNDSVFDGMVA
DTDSSYENLLDTSPAMTREDNELNNISSALTLLESAPSNIVDSQLSLSHGGPISSSDQPL
IHSLLEANHTEETMCNSSRYNDHDDSFSLSYQNIDELRQDKLGELVDVDVKDPLVMSRSL
HNPEQCRISVDDIITSSVEDVVNAICQEDFKVTGLVEEHTTESNLHLMDVDSIIKQKGKR
KLEFQVKAMTEDNAKKSKSDETSLMLPSGSQADASIPDDFKSYPKAATICEDDDTKCNAE
DSALHTDIMSIVREADNKHDGQIGEKHKNNVVGKKDDSTGLRVKKIMRSVGDKAEKEILV
QKLGKEIKEAVQVKTSNCNFEDNAFHGKLLTAFREAIVKPRDEVANKFIPSLRMRKQLLQ
KGKVRENLTKKIYATSSGRRRRAWDRDWEIEFWKYRCPKLKPEKIETLQSVLELLKKAST
SCMENPEMDQGPQGDMSNSILSRVYLADASVFPRKDDIKPLSAAAVIGNDQKEKSLKAPC
KRGSPDSGQILKEQANVSNMAKNDKRKWAMEILARKNALTSSNSVNDGQEEGNMLKGNYP
LLAQLPSDMRPVVAPSRHNKVPISVRQAQLYRIAEHYLRRTNLSVICRTADVELAVADAV
NVEKDISERSNSKMVYINLCAQVLSQCTRLQSDAGPSDSLVNTKSSADQAVEKSENCIDR
VAKKAISEPKPVVFGDVEEALRVAGLSDSPPNSPEKNNSKMKGMFSIIGSEEPLKCPNYE
SQEPASSTKSLVATNQDDLIVEVPSNCSTLLQYQNVCGKGNAHVNVEVDVSTATKIFQGD
EINVLSSTEHNKLHGPEKEPPLDTSSELMGEACKIMEREAAGKSSINNEKEDNSSKDEFA
VPKLEIGNCSKSNILGDKVPFEGRSSGRRNSPNSIMSEIAPKVEQAKPSTADSSDSSHPI
YKKVEAYVKEHIRPLCKSGVITVEQYRWAVTRTTDKVMGHHCNAKNANFLIKEGDKVKKL
AEQYAEVAQQKM
Download sequence
Identical sequences M0SJH6
GSMUA_Achr3P31620_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]