SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P00060_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P00060_001
Domain Number 1 Region: 6-241,290-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-63
Family BAR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 500-641
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.01e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00023
Further Details:      
 
Domain Number 3 Region: 734-829
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-24
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 293-333,373-446
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-23
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P00060_001
Sequence length 837
Comment pep:novel chromosome:MA1:4:25633:47316:1 gene:GSMUA_Achr4G00060_001 transcript:GSMUA_Achr4T00060_001 description:"ADP-ribosylation factor GTPase-activating protein AGD3"
Sequence
MYFAKLDDSPMFRKQIQSLEESAESLRERCLKFYKGCRKYTEGLGEGYDGDIAFASSLEM
FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEQMLNERLLQFVDTDLHDVKD
ARKRFDRASLLYDQAREKYLALKKGTKADITTVLEDELHSARSSFEQARFDLVTALSNIE
AKKRYELLEAVSGTMDAHLRYFKQGYELLHQMEPYIHQVLAYAQQSRERSSYEQAALIER
MQEFKRQIDRESRWSANGSNDSPNGDGIQAIGRSSHKMIEAVMQTAAKGKVQTIRQGYLS
KRSSNLRGDWKRRFFVLDSRGMLYYYRKQWSRSSGGHHPNQRGHNSSEHGPGLLSRWFSS
HYHGGVHDEKCVARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESAMDQMDWI
EKITGVIASLLSSQSPEQRLLTSPMSGGHHRAASESSSFGSSCDLDHLASEESSLEKCSI
GGHFDCSIRSSQQYRFNSKHEKPIDVLRKVCGNDICADCGAPEPDWASLNLGILLCIECS
GVHRNLGVHISKVRSLTLDVRVWEPSVINLFQSLGNTVANTIWEESFPSTSNGKCENVSS
FCIVDKTQGYYCINKPKHSDPITVKEKFIQAKYVEKLFVHKTAADQLSVAQKMWESVRAN
DMKAVYHHIVASNADVNIIYGQASVNSSVTLAKAMLLQDQPTAVLDYSSSCLLGDSLQKS
STMSSFSSVGTSDNINEVDDCFEGFTLLHLACLTSDMAMVELLLQYGANVNSIDLKGRTP
LHHCILRGKHLFAKLLLTRGADPHATDEDGKTALQCAIEAGNIKDEEIIVLLGDPNR
Download sequence
Identical sequences M0SJS3
XP_009395182.1.42102 GSMUA_Achr4P00060_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]