SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P02080_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P02080_001
Domain Number 1 Region: 20-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-49
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 320-378
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000204
Family RING finger domain, C3HC4 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P02080_001
Sequence length 502
Comment pep:novel chromosome:MA1:4:1844071:1848859:-1 gene:GSMUA_Achr4G02080_001 transcript:GSMUA_Achr4T02080_001 description:"Probable E3 ubiquitin-protein ligase XBOS32"
Sequence
MGFLGIMGNSFGCSASGERLVSAARDGDLQEAKALLEYNPRLARYSTFGVRNSPLHYSAA
QGHHEIVSLLIESGVDINLRNIRGQTALMQACQYGHWEVVQTLILFKANIHRTDYLNGGT
ALHFASLNGHTRCIRLLLADYIPSAPNFWNMMRGKSTRESSTPDFDKSALSKFVNQKADG
GITALHMSALNGHAESVHLLLDLGASVFEVTVEDGSTIDLIGAGSTPLHYAACGGNAVCC
QVLIARGASLTAENTNGWTPLMVARSWHRNWIEGILSKRPDGRIKILPSPYLSLPLMSII
RIAREVGWRGTNQSPACIDPCVVCLERRCTVAAEGCNHEFCTRCALYLCSTNSTSTVVPG
PPGSIPCPLCRHAIVSFFKIPGMSPIRELPRTSLSLSLCATCPAVDGSDSTASMATQLCK
PDFHCTRVPPLGSSSFRSLSCQRFPSMKLHSMLCMGVPETSPCLIRCCRSGSSLRRSASQ
RESSTRSCLFAFSPIVDTSDGS
Download sequence
Identical sequences M0SKC5
GSMUA_Achr4P02080_001 XP_009394913.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]