SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P05010_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P05010_001
Domain Number 1 Region: 715-842
Classification Level Classification E-value
Superfamily Plus3-like 4.05e-32
Family Plus3 0.001
Further Details:      
 
Domain Number 2 Region: 571-649
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 8.07e-22
Family SWIB/MDM2 domain 0.00072
Further Details:      
 
Domain Number 3 Region: 1041-1098
Classification Level Classification E-value
Superfamily GYF domain 1.12e-18
Family GYF domain 0.00054
Further Details:      
 
Domain Number 4 Region: 341-399
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000211
Family PHD domain 0.0098
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr4P05010_001
Domain Number - Region: 1587-1609
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000361
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P05010_001
Sequence length 1609
Comment pep:novel chromosome:MA1:4:3901158:3916874:-1 gene:GSMUA_Achr4G05010_001 transcript:GSMUA_Achr4T05010_001 description:"Hypothetical protein"
Sequence
MPQGLPVVSSSRSDSGLLKFAAFESDATTSSAGGKDSVREAMSKMDVDSVPISQCNQGKD
FVQKEVLMPQGSPAVSPSGSGGSLLKFAAFESDATDTNACDDDAVEEAAPKMYVDSAPVP
QCHQGKDGVQGEVLMPQGSPAVSSSGLNGGLLKFGAFDVDTSANNADDTATVEEEVPQID
VDGLPNVTCKQADVCEEVDVSMPKSPSAMLPFGSGGGLEKIASCEPVAVATTCDDDAVKE
VALACADTLDNVALPLYEQMVNAEMGTKMLRGSLDEFPSVSDRGDENIAAIEPDAASTSY
GKTDAMDDEAAQMDAETDDTLVVVQAGGGRRKRGRPTKSQVARTPLKRKEEEEVCFICFD
GGDLVVCDRRGCPKVYHPSCVNRDEAFFRSKGRWTCGWHICSSCERSAHYMCFTCTHSLC
RGCIKEAGFFCVRGNKGFCETCMSTVMLIETNAHGNQEMVGVDFDDKSSFEYLFKDYWLD
LKAKLSLSLEELTRAKNPMKRSDVAIGNEESSDDLHHVKEEQIASSDSSSEHKEESISSR
RKVRKKSRNTINEEVLVKEVETPRQSVCRDISWASDELLEFVAHMKNGDRSVLSQFDVQG
LLLDYIKRNNLRDPRKKSQIICDSRLKNLFGKPCVGHFEMLKLLESHFLIKEVSPLDTED
KQGGVVDPDPDPDPDQTDTKGISDASMKLAPDKRRKTRKKVEKELLTNLDDYAAIDTHNI
SLMYLRRNLMEELLDDISFDEIVIGSFVRIRISGVGQRQDMYRLVQVVGTGKAAESYKSG
KKTTDVTLETINLNKKEVITIDAISNQEFTEEECKRLRQSIKCGFIDRLTVGDVQEKARS
LQPVRVNDWLESEKLRLGHLRDRASEKGRRKEYPLAGWTFGHKSFKEHFGYQVECIEKLQ
LLNTPEECNRRLNEVPEIHTDPHMDPDYESAEEEEESDLRKQDYYDRSRGSSFLRNGREV
KSPGKGSSTLSDNRSSSRKNSNTWDSNRSALVDGASIADSSAGRDVNTTEFSLNQANDVR
QANNSEASKSHVTASVSDATVANESDKIWHYQDPSGKIQGPFSMTQLRKWSNTGYFPPKL
RIWRASEKQEDSILLSDALVGKFQKDLPEWEPPHNSTSQSDAYYENPHPNWSSTSQQLPS
STSEVEPVNDSYHRRNGSTNVPPTPQPSKKSLIAEGSLNKHLPSSASVQAIASAWVNTGG
REEPQSSFTINEPSRGISNSLRELGSFSSQSVPEQTVTSGGGQSLAASLSAPDTVFLGQA
TNLSHHPDKVDAAGSFQKKNSELELSFLLQSQHDHGKESLRTRGRSADETRKKSERLSIK
LDTSSSSAQRSQTSANANAVPVQPNQLGFDTGSNVQNTSFPVASQNPSPNSGPVQGTGNM
SWAPMPQGNINVGWGMVAQGNMNMPWGQPAQAIAGLNMGLGAQNQVNTMMNPGWVAPAQG
NTNMNVAWVTPAAGNTNQTSGWGGHMQGNLTVNPVWAMLLQGQPNPNPGWAAPPYPNATQ
NLEAPMQGTVNMNSAWGSGQGNMNPSWVPSAGNPQSSSIQPPSHGGDRNSGQGDNLQGND
SGHTNQRPLWNRTQAGGGSSLPPRGQTGICRFHEMGHCKKGASCNYFHS
Download sequence
Identical sequences M0SL68
GSMUA_Achr4P05010_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]