SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P05190_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P05190_001
Domain Number 1 Region: 445-573
Classification Level Classification E-value
Superfamily Plus3-like 5.89e-32
Family Plus3 0.00098
Further Details:      
 
Domain Number 2 Region: 306-382
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 4.36e-21
Family SWIB/MDM2 domain 0.00079
Further Details:      
 
Domain Number 3 Region: 783-841
Classification Level Classification E-value
Superfamily GYF domain 5.49e-18
Family GYF domain 0.00061
Further Details:      
 
Domain Number 4 Region: 84-133
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000221
Family PHD domain 0.01
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr4P05190_001
Domain Number - Region: 1275-1296
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000188
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P05190_001
Sequence length 1297
Comment pep:novel chromosome:MA1:4:4011147:4022691:-1 gene:GSMUA_Achr4G05190_001 transcript:GSMUA_Achr4T05190_001 description:"Putative plus-3 domain containing protein, expressed"
Sequence
MPQVSLAEFPSVSDREDENIAKIEHDASTMSHGSADVIDDEPAQKDAKTDGTSVVEQRGG
GRRKRGRPPKAQGQAARTLSRRKEEEEVCFICFDGGDLVVCDRRGCPKVYHPSCVNRDEA
FFRAKGRWTCGWHICSSCERSAHHMCFTCTHALCRGCIKESGFFCVRGNKGFCQTCMSTV
MLIETNEHGNEKMIRVDFDDKSSFEYLFKDYWLELKAKLSLTLEELTRAKNLTKKSDLAT
EKEDSSDDLHNAKQAQVSSSESSPEHKESLSSRRKIRKRSRNTVNEEGAVKVVENDGTSV
SRDSNWASDELLEFVLHMKNGDRTVLSQFDVQGLLLEYIKTNKLRDPRRKSQIVCDSRLQ
NLFGKQRVGHFEMLKLLESHFLLKDVSPLDTEDKQGGVVDPDPDTDQTNARTSDISLKIM
PDKRRKTRKKVEKELLNDLDDYAAIDVHNISLMYLCRNLMEELVDDISFEEKVIGSFVRI
RISGVGQRQDLYRLVQVVGTSRAAERYKSGKKTTDVTLEILNLNKEEVIPIDIISNQEFT
EEECKRLRQSIKCGFIGRLTVGDVQEKAGSLQAVRINDWLESEKLRLGHLRDRASEKGRR
KEYPLILHFLIVTNLLSIIPSARMLVSMGLYESMPGCLFMWLECVEKLQLLNTPEERNRR
LNEVPEIHTDPHMDPDYESAEEEESDIRKQDYYNRSRGSSFVRNGKEVKSPGKGGSILSA
SWSGLRKNSNTWESNRSTLIEGASITDSSSGRGVNTIEFSLNQANDVCQASSSEASKNHG
IATIANESDKIWHYQDPSGKVQGPFSIIQLRKWNTTGYFPRNLKIWRTSEKQEDSILLSD
ALVGQFEKDLPEWEPHNNSTSQSATNLEGIQRGSINIALSNSKNDAQKHKFGENEKWDTR
DSSNVSIPTAQPSSKCWLIAEGSINKHLSSSASLQTTTSASTSDPSKDPKENTHVTEVEN
LAPAASSKIFRVDSMRNSAPLAVSVDNQLHQTLTIPYPGSNLVPEVSSEAPDLSAHPSNA
AANLFSSNKSTPSVPHMTPNGWNTATDSAIGNNTHSLPSDGSNTLSSSQFGVNATLVPVQ
QTQLGFDTGSSVQNTGFAVAAQNPNLNLGPVQGTGNMNWTPVPQGNLNAGWGMVAHGSMN
MPCGQSAQTIANLNMGLGAQNQVNTMMNTGHHTNPSPGWVAPAPSNANRSWETPAQGTMN
TDASWGSQQGNINPCWVPSAGNSQSSSTRPPQSRSRHLGRCDNLQGNDSGQAKQRPSWNR
MQSGGGSSLPPRGQTGICKFHEMGHCKKGASCNYFHP
Download sequence
Identical sequences M0SL86
GSMUA_Achr4P05190_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]