SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P05400_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P05400_001
Domain Number 1 Region: 156-265
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-32
Family Ankyrin repeat 0.00043
Further Details:      
 
Domain Number 2 Region: 32-122
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 4.97e-27
Family Acyl-CoA binding protein 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P05400_001
Sequence length 276
Comment pep:novel chromosome:MA1:4:4175827:4182743:-1 gene:GSMUA_Achr4G05400_001 transcript:GSMUA_Achr4T05400_001 description:"Acyl-CoA-binding domain-containing protein 2"
Sequence
MLSKLIPPTKNTAKSRSLLDDDSDWEGIESTELDETFSAATAFVAATAADKNSAKVSNDV
QLLLYGLYKIATEGPCTVPQPSALKMTARAKWNAWQRLGTMPPEEAMQMYIMIISDLYPS
WADGSTKANTLPSSSTAKGTMGPVFSSFVHEEESETDSKLEPIHGFARDGEADALLALIA
NGALVNSRDSEGRTPLHWAVDRGHFRVVEILLNKDADVNAKENDGQTPLHYAVLCEREEI
AELLIEHHADQHIKDSDGSSPLDLCGSRWDFMATSK
Download sequence
Identical sequences M0SLA7
GSMUA_Achr4P05400_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]