SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P05620_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P05620_001
Domain Number 1 Region: 20-74
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000247
Family PHD domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P05620_001
Sequence length 1258
Comment pep:novel chromosome:MA1:4:4335043:4342849:1 gene:GSMUA_Achr4G05620_001 transcript:GSMUA_Achr4T05620_001 description:"Putative uncharacterized protein"
Sequence
MVFISKFSAECPGIIQFEYNFNVKVCDICGDSGLEELLAFCSRCSDGAEHTYCMQVRLDT
VPESEWICEECRLKEAQNEMIGKFESQLEAIEAVCSSENSQSIESTSKSLPGVENKAVDL
GTTKDNKELDKLALSKRTEEKFDVTKEKISEACGASTGTTVSRKPTLVVCDNTINKSDLV
KVKLPALVTSCCQSEGISRPGANAQSSSYSNSYKLQTHFELTKGSLSKSVSFNKSKVPKV
KQLLENIPHKQKMTREYSLSSMRKGGPSQAITKSASFRSESSGFSNVSTVGDVLLPNPPP
CEDLRDVKQVKEKSMTDKRLFMSDRPFTSLSVAATSVSSVKIAPKVLQYEATPEVMLDPS
KLSNNRGSKEATNQYFGLLAKELKQLPISPISQTSGSTSSVRSCKNEDQKPLHHGAELIH
KDDKTKDHTFLSNIRQAASVDNRLARCQRCNESGHSTQFCAVDKLHMSAMKPSLKRNSKD
VDYRSGKWKDAVDVFTLESGTKRTARSPDQSMEVSMSSGDVHSEATSKDFPSSLISSRNL
AFMEHASVAQDFSNTANAIHVKQKVEDRKKYTFLPRKVTPLDFADDLNMQPVIQTLPDQV
SMPLHLLRASVIPELDCIWEGVFEVLKIAKPPAFLDGIQAHLSSYVSPKALELVKKFPCK
VQLEEVPRLSAWPFQSHENSPKEDNIALFFFAKDTESYEKSYLNLLEDMLKNDLALIGNI
DAVELLILPSNLLPANSQCWNKLFYLWGVFRGRNISCFTDLPDLEKKPSVSSLNLEPTVQ
DQSIPDFSGLCSSYEIYDENSQELSRFDKFPKAKAIISSSCSNIQDVPCSGNKDRILNIK
QIPPVQNLHLAVCGDKVLTEQTSCSCSASCPYTNVSQLPNVPVAYPEPKLQIDIEQLPLE
MENDLTDLGKLAGDSEGSKDSEHHANASSTSISNCEEPVFLVLFNCQQGNARNVQKIKQK
EKFITSEAVPDDQVSDAIKLDDLSWESRHNKKRRLPSSAETIIKPTADRMLWKDEASCTS
MNDTELKKMRLDNGGHAACSSREETLSSGLPSKIHPLPSGCLNDGIGCDTMCESSKNAER
FFPIDLGTATSTKADNLIYVLSSDDEDSPESMAPDLELALWGKKRPPKTDSSPWLSPNVG
IKRNPDKPLAPAVDDRDDMLASLSLSLAFPATEKPRSDKPMTQDEQLLPDKPCINTSLLL
FGGGGGGSRGGGGLLRSPELRGRHVAAERGEGARLLLGGGREGVCEAKGSAAGHHIPG
Download sequence
Identical sequences M0SLC9
GSMUA_Achr4P05620_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]