SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P11350_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_Achr4P11350_001
Domain Number - Region: 212-289
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000399
Family PHD domain 0.012
Further Details:      
 
Domain Number - Region: 349-387
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000936
Family PHD domain 0.03
Further Details:      
 
Domain Number - Region: 642-702
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00273
Family N-6 DNA Methylase-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P11350_001
Sequence length 1197
Comment pep:novel chromosome:MA1:4:8131017:8152211:1 gene:GSMUA_Achr4G11350_001 transcript:GSMUA_Achr4T11350_001 description:"EDM2, putative, expressed"
Sequence
MASSDDDEIVPQIVTNYHLVDDDESPISFSVLPVQFSDGENQDAVNRAVFLHGTTDGGLQ
KVYKQVVAWKLVLEDDQPKIMVLSKDKKWINLLKPRKSYEDTIRTMLITIQLLHFLRRKP
QASEKSLWEHLRGVFSAFEVRPSEDDFREHISLMKLFRERDQVLVNSQLLLEFLEGKPRK
KFGEVALDSSNLNQPFIADDDEVDEDIKDDADDDSEDESDLFDSVCAICDNGGELLCCEG
PCLRSFHATRKAGEESECKSLGYTKAEVESLQNFLCNNCLYKQHQCFGCGKLGTSDKSKG
AEVYPCVSATCGHFYHPKCVSELLFPGSEAEASEFQKKIVAGESFTCPVHKCVVCKQGED
KEVRDLQFAMCRRCPKSYHRKCLPRRIAFEDIEDEAIIQRAWDDLLPNRILIYCLKHTVD
EDLGTPRRNHIIFPETPEKKIVSDMQKSKIKELAKNKVRELARDRTTMKSVKATSSEGNH
SKEKVVRSVTQHGLGIQKKEMSLKDKSRSDMDKAERTVFEDNKTPDKEAKPIASTKPAAK
TLSSFPHIDSETEAKVLALFEKASSSLSLENITRKRSMPSTHAYGTRHIDKTITQGKVEG
SVEAIRTALQKLENGGSVEDAKAVCEPEMVKQLLKWREKLRVYLAPFLHGMRYTSFGRHF
TKVDKLKQIVDKLQWYVQDGDTVVDFCCGANDYSILMKEKLDAAGKRCYFKNYDIIQPKN
DFNFERRDWMKVNPKELPTGSKLIMGLNPPFGVKAALANKFIDKALTFKPKLLILIVPKE
TERLDKKSPPYDLIWEDGQSLSGKSFYLPGSVDVNDKQMEQWNLSPPPLYLWSRADWTTK
HKTIASHYGHTFTEQEIPVEESLVKKPSEVLAAEDHMEQEPLKGVATSEGTEARKEDTKS
SGRSNKRFSAENRSGGSRKRRRSKKKAKVSEAKEVDKLSDMSISPDHLESRTRSQSHLPS
EPIETPSERANNQDVYFSSGMEFGVTTGGNDIFKDIVNDDIDEIARRYTAPAAGEGMFNR
NSHVWPTGGIGTHDYGVPSSDSRFSDYPRSNIDSLSRNTYSNDIDGYRRISETDLRAQIR
LYGTQGQDEWSQRNGMLLGSSDSVLGQPRLFPPPSYGPSTASMVTSAMDRYAPRLDEANY
VRPRNQGPVGPLPGTGSIFDYDIHGMRRDRPPNSIGFAPGPHPSYPHPGTSGGWLDE
Download sequence
Identical sequences M0SN00
XP_009396089.1.42102 GSMUA_Achr4P11350_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]