SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P13890_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P13890_001
Domain Number 1 Region: 83-167
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000106
Family Ankyrin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr4P13890_001
Domain Number - Region: 275-305
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00314
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P13890_001
Sequence length 658
Comment pep:novel chromosome:MA1:4:10401772:10405014:1 gene:GSMUA_Achr4G13890_001 transcript:GSMUA_Achr4T13890_001 description:"Zinc finger CCCH domain-containing protein 24"
Sequence
MCGGPERIKPSSSSSPAPTSRGEHQQHGPVLGMNHLTVEIADSSSLLELAANNDAEAFGR
SLDRDPLAVDDVGLWYGRRKGSNRMVLEHRTPLMVAATYGSLDVLKFILSLPSVEVNRAS
APDNTTALHCAASGGSFDAVDAVKALLAAGADPTLVDVNGDRPADVIVVPPKLPDVKSAL
EQLLGRRSNASGGGADHHHLPLGDPDLPPVRVSEKKEYPVDPSLPDIKNSIYTTDEFRMF
SFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKYHYSCVPCPDFRKGSCRRGDMCEYAH
GVFECWLHPAQYRTRLCKDGTSCSRRVCFFAHTNEELRPLYVSTGSAVPSPRATSAAMEM
AAAMGLMPGSPSSVSAVMSPFTPPMSPSANGIGHSSLGWPQPNMPTLNLPASNLQASRLR
SSLSVRDIPPDDLSAISEFDTQQLLNDLCYSRLKVAISPRYNSDQGAVFSPSHKAAILNQ
FQQQQSLLSPINTSVFSPKAPVSPVSSRLAVLSQRERQQQTLRSLSSRDLGPISSPVVGS
PVNSSWSKWASPSGTPDWTVNGEELGRLRRSSSFELRGNGDEPDLSWVHSLVRESPPEKV
ISAAMASAGPSSLSAVGGENLNSNGQMNGHDQPALLGAWLEHQEILDGKHSVIFNSNI
Download sequence
Identical sequences M0SNQ4
GSMUA_Achr4P13890_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]