SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P18160_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P18160_001
Domain Number 1 Region: 103-226
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.33e-27
Family Ankyrin repeat 0.00092
Further Details:      
 
Domain Number 2 Region: 556-602
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000141
Family RING finger domain, C3HC4 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P18160_001
Sequence length 608
Comment pep:novel chromosome:MA1:4:18784283:18803009:-1 gene:GSMUA_Achr4G18160_001 transcript:GSMUA_Achr4T18160_001 description:"Probable E3 ubiquitin-protein ligase XBOS34"
Sequence
MNASRVRVGQRQLISVLYGALSHPCIRKKIGFDGLVILNLQTLVEPFIDAEFDSFPSKEN
RNVLSLSSLVSVDLVVPVILFLHKRFFDLRSKDYSMGLQQSKEELLYQQVNYGNIEGIKA
LRSQGAGLEWMDKEGKTPLIVACLRHDLLPVAKILIELGANVNVYRPGCHAGTPLHHAAK
RGLEQTVHLLLSNGANPFIMNDDCHTALDLAREKGHCNVVRAIESRISLFTGWLREVYGP
GFLEALVPQLLTRKIWSVVLPCDARNPTRPLKFELAIYSDLQTARPRTVVPLWKVHIEEP
KFNQVDPAVIIVDKATRARYKFLSAREGDKQQLQWFFSSCQGISQVTNSLPVMPVDVSMP
SPPQIISSASTQSTAAPTSNPEDLELAMAINASIQTAISEGVPDIQPNPQTSNTNDWASS
SDNSTYNGWDTPNADTSSKMNGQGSTNEPYASNGWEVQLNTSASQPNVQNPDTPVIQSSQ
GAPPTQLVPSAPPVTEDTFYDGPIHYPSIDCSPIDMKMSAVEDAPGTAEAKDGSTSSYSK
PGSSEDKAESKSSSGCCVICLDAPVEGACIPCGHMAGCMSCLRDIEAKNWGCPICRAKIK
QVIKLYAV
Download sequence
Identical sequences M0SPX9
GSMUA_Achr4P18160_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]