SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P19180_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P19180_001
Domain Number 1 Region: 341-399
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000159
Family PHD domain 0.0062
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr4P19180_001
Domain Number - Region: 1418-1453
Classification Level Classification E-value
Superfamily Mitochondrial carrier 0.0876
Family Mitochondrial carrier 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P19180_001
Sequence length 1471
Comment pep:novel chromosome:MA1:4:20229611:20245482:-1 gene:GSMUA_Achr4G19180_001 transcript:GSMUA_Achr4T19180_001 description:"Putative uncharacterized protein"
Sequence
MRVESGTCNVCSAPCSSCMHRIAVAMESNVDCGSSDNTFQMKEADNCSFTRIKSRFCDDL
QTAVSETSNLLSGSSSNDSYTENAESKATLRSSFTYDTSEDVDIPPEISTVEAHNVSRCY
TNNDSCITGAGDTNMLGLDHNLELEKRSGSLLSTCKFGVRETEMVIQVETTHESCGCNME
ANQVKSRKLITFPQESSRKKSPGPLNVGLPSNSVLTNTSLMKNISPKLDSNSPCRSDLIS
CHNADSNGIEANQPSQVHGESHDCLVADVESSYQVLLSAGGNHGQKSVVFSDSEATKSIQ
IGSNTSSGEFKNGDQFFESASDFDRSKSNLYKSGTGQASEPESMLYDVNVCDICGDAGRE
DLLASCSRCIDGAEHTYCMQIMLDKVPERDWLCEECQKKEDLDTRSTNPEACGSSKQIQS
PRTTSKKQMDRVDVGPVTKKKASETSDEPLRTASPRIATKFSRESSFKNLHMAQVKQTNI
ASTLGDHSTNSSQTSRLLTLDRFLSKQVSFKKSAEPKVKQLVEGVSQKLAKESTSSNTKQ
MLIRTVNRSASCKSVSSGHHNVKSLIKAQSLKTPRADPKSFNPNKERGVMERKSSFDLDC
QLISPPPVGRKPLPKLDVKIAPPNSNASNKSELSILCSSKGFDRENNFGKQSAVTGVNHV
VGHVKLTEAKCGQIDRPNMSAAKPSVDVGLVDGTNKRNKWKDALKAAISKNKMSRTVDQS
ECKLLKNNIICEDSSRSSLTSSSCLKDLPLEGAPYGKVILRVSDTDNGRTDSASDAEQTK
HLTESSYVPGVGDLNVNPINPDALNEKSSAQILPDHPSPLTTDFRFLVVPEHKFIWQGAF
EILRIGRFPKVVEGIQAHLSNFASPKVHEVACRFPCNIQLEEVPRVSLWPLQFQETGPKE
DNIGLYFFAKDAESYEKSYQKLLDAAQKNDLAFKGSINEVELLIFPSNVLPESSQRWNML
FFLWGIFKVRKQDSSKPYTNLQQESSGSKINLESQVQELSSYHACELSTFQKHDLQQYPP
KEFSIYDETPGARTLKFNSIDNCQFVSSTVPDNDTHNAENFPSVKSSLDMVTVETESNGV
SDHASHYLYSFDYQKICPASKSNGTKSVHIYCTDLSEDLGPPLVLDPDFNTWNDTDVEVG
KSPHVFANSVQQKLDESLPEYLAASGFREGKEGTEGSKGKKRLVKIEDESEENFSIWGSK
PSTKCVHSFPTVYCGESSKSTIPNMLQEATFVSLEGGREHKRMKCDSEGHVISLREQSTE
CRLLPTTQPFSATYLDEQQRDGINYNNEVPESSICTERCFFPQDSFPAGTKMVENSRYFL
PRVDEDLSGSRTPDLELALGGKKLPSEEGMFPLFFPSVDKGEPDKPSGSEDDDHDRQDTL
IQSASPKCLGGLSCFICCCKVQRTLSMLQSMSCEKLVLRGLYKGLVRILERKVPGNIAAL
FGVYEALKWYFAGNSSSFILEQRRINSQKKN
Download sequence
Identical sequences M0SQ81
GSMUA_Achr4P19180_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]