SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P19780_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P19780_001
Domain Number 1 Region: 558-691
Classification Level Classification E-value
Superfamily SET domain 1.8e-18
Family Histone lysine methyltransferases 0.01
Further Details:      
 
Domain Number 2 Region: 381-444
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.32e-17
Family PHD domain 0.0023
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr4P19780_001
Domain Number - Region: 14-128
Classification Level Classification E-value
Superfamily POZ domain 0.000157
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P19780_001
Sequence length 701
Comment pep:novel chromosome:MA1:4:20625801:20629422:-1 gene:GSMUA_Achr4G19780_001 transcript:GSMUA_Achr4T19780_001 description:"Histone-lysine N-methyltransferase ATXR6"
Sequence
MEQACSAKTRGFGDRTTSDVTVCLRNRDGRPEWFHCHSTILRRESKYFADRLPENRPASP
SHDTGNCIEVHCTGNEYDNYVKVLKLLYLSEESVLDSWDSVKSAIGVLRVSVSLQCRSII
QSCILYLEAVPWEEDEEEEIIKVASSLGPEAQPLLARIKPVSTNDTKNVFLSAYMLLEDE
DAPLVAVDDDVKSEWMCNIIPKMEMMKEFVFGWAHVSDHILAVIQDEKYSSSLWSVKAKS
IEVTGKALDAIGYGSVVLPAPFRVHFLRTWLPYIRKMKHLLDLKSMEDESFPYKMDGDLC
QNVEGAITSLVLALPSNDQAEIFTDWMKKTEQLSYPDLSEAFEVWCYRTKAAKRRLMASL
NEAGNPATPFRRRTNAPSSSSLSSAVLDAIRCEECGSGESADKLLLCDRCDRGFHLFCLR
PILACVPKGLWFCPPCSAEKRPKRFPLIQTRIIDFFRIQRSSGLEKLECRKRKKRSGGLV
VAKKKRKLLPFNPIEDPDRRLEQMASLATALTATGAVFSNELTYRPGMAPRSANRAANEN
GGMQVLSKEDVETLNLCKRMMERGEWPPLMVVHDPLEGFTVEADRFIRDLTIVTEYVGDV
DYLKNREHDDGDSMMTLLSAANAARSLVICPDQRSNIARFINGINNHTREGKKKQNLKCV
RFSVDGECRVLLVANRDISRGERLYYDYNGSEQEYPTEHFV
Download sequence
Identical sequences M0SQE1
GSMUA_Achr4P19780_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]