SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P24620_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P24620_001
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000487
Family PHD domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P24620_001
Sequence length 109
Comment pep:novel chromosome:MA1:4:24344772:24345270:-1 gene:GSMUA_Achr4G24620_001 transcript:GSMUA_Achr4T24620_001 description:"zinc finger protein, putative, expressed"
Sequence
MSSTHTAVCSMCGDVGFDDKLFRCVRCRSRFQHSYCTNFYYEEPSETAGVCDWCLSERYE
LPHKKSAGRHAIQPAAGRRSAYAKRRTGRSAPASKPTGRRYKLLKDVLY
Download sequence
Identical sequences M0SRS3
XP_009398933.1.42102 GSMUA_Achr4P24620_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]