SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P26640_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P26640_001
Domain Number 1 Region: 62-130
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000155
Family Ankyrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P26640_001
Sequence length 601
Comment pep:novel chromosome:MA1:4:25854940:25859051:-1 gene:GSMUA_Achr4G26640_001 transcript:GSMUA_Achr4T26640_001 description:"ankyrin repeat domain containing protein, expressed"
Sequence
MAGVDPTKYAHSPAHKAVLARDYAGLKCVLAALPRLAEPLSIVTEAAAVAEEEKADAISA
VIDRRDVPGRETPLHLAVRLGDAAAVEMLMAAGVDWSLQNEQGWSALQEAICFREENLAK
IIVRHYQPLAWAKWCRRLPRLVATMRRMRDFYMEITFHFESSVIPFISRIAPSDTYKIWK
RGSNLRADMTLAGFDGFRIQRSDQSVLFLGDGSEDGKVSPGSLCMISHKDKEVMNALDGA
GTPATEAEVQQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQERSELVGSWKAKVYDMHH
VVVSVKSRQVPGAMTDEEFLSTCNDNDTESEGLEDILTEEERKQLENALKMESPDEAQHS
RQDRKSWFGNWKKRGGNHKQEGQKKVVPPRSSLCVEEKVSDLLGDSPSGRGRDRDSKRTV
TGLENGYRRKESSKESEYKKGLRPVLWLSSDFPLRTEELLPLLDILANKVKAIRRLRDLL
TTKLPAGAFPVKVAIPVVPTIRVLVTFTKFEELQPLEEFSTPPSSPESNSPETLQSSSWI
QWIKAPYRQGYSATSGPSSRVEDIQDPFVIPPDYIWTTPEAKKKKIQENKSKSKKGKGQN
Q
Download sequence
Identical sequences M0SSC6
GSMUA_Achr4P26640_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]