SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P28980_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P28980_001
Domain Number 1 Region: 5-56
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000131
Family PHD domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P28980_001
Sequence length 128
Comment pep:novel chromosome:MA1:4:27179366:27180003:-1 gene:GSMUA_Achr4G28980_001 transcript:GSMUA_Achr4T28980_001 description:"zinc finger protein, putative, expressed"
Sequence
MASTHAVCSMCGDIGFPDKLFRCSRCRSRFQHSYCTNFYHELPAGSAGVCDWCLSEGRIG
DKYELPWKKSERRDSAEAAGRRTAYAKGDKVKQSGRVDDSDSRGSSGSSTSSSKPAGRRY
KLLKDVLC
Download sequence
Identical sequences M0ST10
GSMUA_Achr4P28980_001 XP_009397652.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]