SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P29610_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P29610_001
Domain Number 1 Region: 248-407
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-39
Family Ankyrin repeat 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P29610_001
Sequence length 420
Comment pep:novel chromosome:MA1:4:27499549:27506299:1 gene:GSMUA_Achr4G29610_001 transcript:GSMUA_Achr4T29610_001 description:"Putative Ankyrin repeat domain-containing protein, chloroplastic"
Sequence
MPPLCSHLLSLNISLPFVASPSRYPRSSCHSPPITLPFCSPFPALKPFPPAAAASSFPYS
YQNPDRDQQRDPQLLVPQDEELVIGDCLVFEDGAFEDGDPFDPPSPSEEAGRPGRRRPAA
AASTAETESLVPNNRMERRKKPPVPDMEEYRTYREMKLAQLKPVVLDDPREFPQAAVPPE
QKGLPGGRVAPRNPRLGLDGGTLEDIREFFNSGKYVPRDVDDDKNPQGRRKLFTLEEKVL
LNKRIPNLAEATSSKWLPLHSLAASGEFFLLDTLLKHNVDINGVDKDGLSAIHKAILCKK
QAVINYLLRNSANPFIRDKDGATLMHYAVQTASSQTIKILLLYSVDINLADDDGWTPLHL
AVQTQRTDIVRLLLIKGADKTIRNHDGLTPLDLCLYSGHNSRTYELIKLLKQFPLSKTSA
Download sequence
Identical sequences M0ST73
GSMUA_Achr4P29610_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]