SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P30510_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P30510_001
Domain Number 1 Region: 462-528
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000307
Family Ankyrin repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 99-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000456
Family Plant C2H2 finger (QALGGH zinc finger) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P30510_001
Sequence length 703
Comment pep:novel chromosome:MA1:4:28062256:28068191:1 gene:GSMUA_Achr4G30510_001 transcript:GSMUA_Achr4T30510_001 description:"ZOS4-12 - C2H2 zinc finger protein, expressed"
Sequence
MALLKFQSPLLFFNTKRRDTIRLASPMAATEEKSLAERKPRSVFDLPPGFFDSCRLLRSL
QSETLRRIPDPSPVTAETGVAGSVGERVDVEVESVRAGEMGKEAAASSSRWTCNTCKAEF
DSLQDQRSHFKSDLHRLNVKLSIAGKNIIKEDDFDNLGGDPVYEDFDVSSISGSEDEFEN
DPIHQSCLSSKGKERDKQKPCFYLQSGDIVSVWRCLLMDETEDISFENSKSNHMVSGDTY
LEETELINRLKTLVCEPRDRSHLRIVLLASGGHFAGCVFDGNFVIAHKTFHRYVVRAKAG
KRQSAKDATGKAANSAGSSLRRYNEAALKKEIQELLVSWKSFIDSSSCIFIHAPSRSRQM
FFDGEKPQLSSQDHKIRHVPSTVRRPTFKEAVRIYQQLTSLAYEVDENHIPEEDTSSRVS
CEGNSIPQSNDSNSSGHLEIKKSSSGSGSGVIQGLAIAVEAVNASSYRDETTPLHEAAKC
GDAERTLELLEQGLNPCIKDGRGRTPYVLASEKEVRNIFRRFMAINPDKWDWHAANVPSP
LTKEIEEAQAAKQAEKDAKRKAKAKELKKLRKAKEKAKAQAAISENASAAVSHNQGATAS
AHIQQSQSNQPVLSKEEEQRRALAAEREKRAAAAERRIAALNARLTSTTVAPSSSSAPKS
GAGDAICSCCSASLEGKVPFHRYDYKYCSTSCMHVHREMLEDG
Download sequence
Identical sequences M0STG3
GSMUA_Achr4P30510_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]