SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P32390_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P32390_001
Domain Number 1 Region: 571-719
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 4.45e-21
Family Transducin (alpha subunit), insertion domain 0.0013
Further Details:      
 
Domain Number 2 Region: 542-566,758-929
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-20
Family G proteins 0.0017
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr4P32390_001
Domain Number - Region: 280-330
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00233
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P32390_001
Sequence length 951
Comment pep:novel chromosome:MA1:4:29177407:29186059:1 gene:GSMUA_Achr4G32390_001 transcript:GSMUA_Achr4T32390_001 description:"Putative Guanine nucleotide-binding protein alpha-2 subunit"
Sequence
MMLKQQEMFCIDAIDEKGGQPFEQLDSVVAFNTTPGAGTEVAADGSNLGFRVCISHEYLA
HTHGCLELNCGCLQSTIASRDASYRHQVNLDRGGRKWKSNQRRLSTVPCCPQILDPWGLS
LDPSPSAMDRRLMVVLSAAESADYSFADEYKGPPLPYDIPRAVPIDVDRIPLAAVAPASA
GLPDLPNHAAMDRPGAEVSGALGSFGFPDRSTDLSEVVDSSGAIGFLSSASGDGDEDEAV
ALQAKKALLVTFQESGQSSCSMSPAVGVTPRARSEDLEMKTKKRACHRCLKGSRFTEKET
CLACDAKYCSGCVLRAMGSMPEGRKCISCIGSPILESNRERLGRSSRVLKKLLSSREVQL
VMKAEKDCEANQLRPEDVCVNGTKLSLEEMVLLQSCSCPPNLKPGLYWYDKVSGYWGKEG
HKPDRIITPHLNVGGTLMQNASNGNTGILINGREITKVELQMLKWAGVHCAGNPHFWLNA
DGTYLEEGQKNVKGQIWEKPIMKLLCPVLSLPFPSKVANPSGEEVNNLFSRAVPDCFDTK
ALQKLLLVGHHESGTSTIFKQAKFLYSSVPFSEDEREDIKLMIQTSIYNYLAILLEGRER
FEEESLDEQRDKQHLDSSGDVAFDKQNKVTEYSISPRLRAFSDWLLKIMASGNLEAIFPA
ATREYAPLVEELWKDSAIQATYSRRNELQSLPSYASYFLERVVDISRAEYEPSDMDILCA
DGINSSNGVTYADFPFPCLACVGSSIDDDDQQEALLRYQLIRVHTMGLGENCKWLGMFED
VRIVIFCVAVTDYDEYYEDANGMVRNKMIESRRIFEGIASHPTFEQMDFLLILSKIDLLE
QKLDMAPLTLCDWFDDYNPVVSYHPDNKNRRGAQIGATKSQQAFHYIAVKFKRLFFSITG
RKLYVAQANGLDGDSVDAALRYAKEIIKWEERLVCGIPESMYSTEPSSYSH
Download sequence
Identical sequences M0SU01
GSMUA_Achr4P32390_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]