SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P01490_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P01490_001
Domain Number 1 Region: 709-949,1073-1273,1305-1348
Classification Level Classification E-value
Superfamily ARM repeat 2.65e-30
Family HEAT repeat 0.058
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr5P01490_001
Domain Number - Region: 641-678
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00244
Family PHD domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P01490_001
Sequence length 1720
Comment pep:novel chromosome:MA1:5:851399:873817:1 gene:GSMUA_Achr5G01490_001 transcript:GSMUA_Achr5T01490_001 description:"sister chromatid cohesion 2, putative, expressed"
Sequence
MEFNQDLGFERYCRLSNTTHSEIAPSLSLPSLPVCFGSFDQQLGLSDVPGGSRSGDRPDI
LAHAGTIAELLRNCDVDYLNLKENARVVPDDLGDRSRLYQEVVKYNPDAFKCFYRGPLQE
QRRSNQTIEKKPFGQGVSQVQRDNGGECDDRSEKNLITEPPSFASSRKPKIKKKESDSVP
SSVGPDLLDHQGIVGSFCEMAEDFCGRAEIPDDAEGAEVSSIPLTDIKTLLNQIMSIRSK
KVLQLIPLNTLVRLINILDRQIQCAQGLSIDGNDNADDDAANLVLCALESTHASLGIMAH
QDMPKQLYREEVIERILDFSRHQIMEIIAACNPLHSLPKPSENAPFDGDEEDDDDVDNTN
SSLAKRRRYNRNVNLRKSSGSKISAPVYAVVQKLCSILGFLKDLLSVERLSDSCILQLVK
TSFSTFLADNIQLLQLKSINLICGVYSSYTQHRSFLIDETLQLLRKLQFNKRAIRAYHLP
DEEQKQIQMITALLIQLVQFSSNLPESLKTAANWNAVLDISSDSSSPAKSYEAATQTCCL
FWTSVLQRLTTAKSQDVSESKMILENIIMDLLTTLNLPEYPASAPILEVLCVLLLQNAGL
KSKDISARCMAVDLLGMIAARLKRDAVTCSRDRFWILQDLRCFHPDCLGISGQEMLLRDW
SCHICLCKKQLITLHSYCNMQSKDNAKISLVSASTTSGDSDCVTKLEVVQQILLNHLQQN
GSEDDVNLFTRWFYLCLWYKDDSQSQERVIYYLARLKSKAILRDSGSSLLLSRDGAKKIC
LALGQNNSFSRGFDKILSLLLASLRENSPVLRAKALRAVSAIVEADPEVLCDKRVQCAVE
GRFCDSAISVREAALELVGRHIASHPGVGLKYFEKVAERIKDTGVSVRKRSIRIIRDLCI
SESNFSEATRAFIEIISRVTDEESSVQDLVCKTFFELWFEEPTGSQKHLIADGSSVPMEV
AKKTEQIVDMLRNMPNSHHLVTVIKRNLTLDFLPQSAKATGINAASLASVRKRCELICKR
LLERILQVEEETSDKEEVCALPYVLALHSFCVVDPTLCAPSTDQSQFVITLQPYLKNQVD
NKSVAQLLESIIYVVNAVLPLLRKPPQSVIEELEQDLKHMIVRHSFLTVVHACIKCLCSL
SKIAGKGSSIVEYLIHIFFKHLQGSGSDNMQLLGRSLFCLGLLLRYGGELIVKTDSQHVH
IDKSLSLLKRYLVMDDFGLKVRALQASYILISSPEYMLEKDIGKILEASLASSADFRLKT
QALQNLYEYLLDAETKMGTDCGSKNATSHAEDAGNKVPVAAGAGDTNICGGIVQLYWNSI
LERCLDGNDQIRQTSLKIVEIVLRQGLVHPITCVPYLIALEIDPLDVNSKLAHHLLMNMN
DKYPAFFESRLGDGLQMSFKFVQCIASNHNLVSGLQKGKSDGNPIAYVRPGISRIYRLIR
GNRIARNKFIHSIVRKFESGGGNYLPIGFLVYCTEILASLPFTCPDEPLYLIYDINRIIQ
VRAGALEANMKTWSSVSQHRDSLEMPSEIDKGNANSGWPNISEHDFTEIADKMSDSSRGI
STEDLQKFQADCHEAIALQLLLKLKRHLKIVYGLNDARCQAFSLKELPKPGETISKQNIP
FNISDTPISLPTSYQAMVEKYQEFKVSLREDAIDYSTYTASVKRKRPTPRSSRGGKAAQR
KGEEDDDDVDDEDWTGGPRVLDFSGQRSNGMRMTRQRLQV
Download sequence
Identical sequences M0SUS8
GSMUA_Achr5P01490_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]