SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P02120_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P02120_001
Domain Number 1 Region: 275-380
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-17
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 70-197
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000126
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P02120_001
Sequence length 584
Comment pep:novel chromosome:MA1:5:1357651:1363188:1 gene:GSMUA_Achr5G02120_001 transcript:GSMUA_Achr5T02120_001 description:"Putative Regulatory protein NPR1"
Sequence
MPNATEPSSTISFASSSYLSNCSSAYHAPVAAPNPPVQHAAPDGGTNLEVLSLSKLSSNL
ERLLVDTEFDCTDAEIMVEGAPVGVHRCILAARSRFFRELFSREGSGGAPREGKPRFDMD
ELVPGGRVGREAFMVFLSYLYTGKLKPAPQDVSICVDRFCAHDSCPPAIGFAVELMYASS
VFQIAELVSLLQRRLLNFVEKALVEDVIPILQVASHSKLNQLLTHCVQRVARSDLDDIAL
EKKLPQEVTDEIRSLRRKSQPKESNVTVDPVHEKRIKRIHRALDSDDVELVKLLLSESGV
TLDDTYALHYAAAYCDSKVIAELLDLGSANVNLKNDKGYTPLHVAAMRREPKVIVSLLTK
GASALETTADGQNAVRICRRLTRAKDYFTKTEQGQESNKNKLCIDILEREVRRNPMVGED
AVTSPLLADDLHMKLLYLENRVAFARLFFPAEAKVAMEIAHADTTSEFTGLYKSRSSSNL
RDVDLNETPVVQNKRLRTRVDTLMKTVELGRRYFPNCSQVLDKFLDDDLPDLFYLQKGSP
DEQKIKKLRFCELKEDVRKAFSKDKAGSLLSGLSSLSSSSLPKD
Download sequence
Identical sequences M0SUZ1
GSMUA_Achr5P02120_001 XP_009399066.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]